Q5VSR9 SPXN1_HUMAN

Gene name: SPANXN1
Protein name: Sperm protein associated with the nucleus on the X chromosome N1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9H0X4 FAM234A 0.86966
2 Q8TDW0 LRRC8C 0.80078 cell differentiation GO:0030154
cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
...
3 Q9HBH7 BEX1 0.76392 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
4 Q9UI40 SLC24A2 0.70577 cell-cell signaling GO:0007267
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
5 Q9NZJ9 NUDT4 0.70495 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
6 Q9UKJ1 PILRA 0.68695 biological process involved in symbiotic interaction GO:0044403
immune system process GO:0002376
signal transduction GO:0007165
7 Q9BXT4 TDRD1 0.65278 anatomical structure development GO:0048856
cell cycle GO:0007049
cell differentiation GO:0030154
...
8 Q8IV38 ANKMY2 0.64669
9 Q8TED4 SLC37A2 0.6455 transmembrane transport GO:0055085
transport GO:0006810
10 O60238 BNIP3L 0.63738 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cell death GO:0008219
...

                                           20                  40                  60        
AA:                      MEQPTSSINGEKRKSPCESNNENDEMQETPNRDLAPEPSLKKMKTSEYSTVLAFCYRKAKKIHSNQLENDQS
STMI:                                                                                            
DO_DISOPRED3:            DDDDDDDDDDDDDDD...................................................DDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................DDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............D.DDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................DDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
RICH_[N]:                        NgekrkspcesNNeN                                                 
RICH_[EN]:                       NgEkrkspcEsNNENdEmqEtpN                                         
RICH_MOBI_[N]:                   NgekrkspcesNNeNdemqetpN                                         
RICH_MOBI_[EN]:                  NgEkrkspcEsNNENdEmqE                                            
RICH_fLPS_MOBI_[N]:                      cesNNeNdemqetpN