Q9NZJ9 NUDT4_HUMAN
Gene name: NUDT4
Protein name: Diphosphoinositol polyphosphate phosphohydrolase 2
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96GC9 | VMP1 | 0.84068 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell adhesion GO:0007155 ... |
| 2 | Q9NV23 | OLAH | 0.8176 | |
| 3 | A8MYZ0 | MINDY4B | 0.8093 | |
| 4 | Q92851 | CASP10 | 0.80884 | cell death GO:0008219 signal transduction GO:0007165 |
| 5 | Q8TDW0 | LRRC8C | 0.78849 | cell differentiation GO:0030154 cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 ... |
| 6 | P56880 | CLDN20 | 0.78621 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 7 | O95758 | PTBP3 | 0.78468 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 8 | P60228 | EIF3E | 0.78399 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 9 | Q9NYP7 | ELOVL5 | 0.7728 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 10 | Q8N695 | SLC5A8 | 0.76635 | biosynthetic process GO:0009058 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTV STMI: DO_DISOPRED3: DDD................................................................................................. DO_IUPRED2A: D...DD.........................................DDDDDDDDDDDDDDDDDDD.................................. DO_SPOTD: DDDDDDDDD........................................................................................... CONSENSUS: DDDDDD.............................................................................................. CONSENSUS_MOBI: DDDDDDD.................................DD..........................................................
120 140 160 AA: TEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR STMI: DO_DISOPRED3: .................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ..................................................DDDDD..D...................D.. DO_SPOTD: .............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ........DDDDD..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[N]: NgNstvpslpdNN RICH_MOBI_[N]: NgNstvpslpdNN RICH_fLPS_MOBI_[N]: paNgNstvpslpdNN