Q5VUM1 SDHF4_HUMAN

Gene name: SDHAF4
Protein name: Succinate dehydrogenase assembly factor 4, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- generation of precursor metabolites and energy GO:0006091
- immune system process GO:0002376
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5VZL5 ZMYM4 0.65331 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell morphogenesis GO:0000902
...
2 Q9Y4E1 WASHC2C 0.62955 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
3 O60524 NEMF 0.62491 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
4 O95905 ECD 0.6203 biosynthetic process GO:0009058
cell cycle GO:0007049
cell population proliferation GO:0008283
...
5 Q641Q2 WASHC2A 0.62022 protein transport GO:0015031
transport GO:0006810
vesicle-mediated transport GO:0016192
6 Q9H446 RWDD1 0.61973 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
response to stress GO:0006950
...
7 Q6KC79 NIPBL 0.61338 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
8 Q9H4A5 GOLPH3L 0.60939 membrane organization GO:0061024
protein transport GO:0015031
transport GO:0006810
...
9 Q8TAM6 ERMN 0.60642 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cytoskeleton organization GO:0007010
10 P83916 CBX1 0.60616 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
response to stress GO:0006950

                                           20                  40                  60                  80                 100
AA:                      MTPSRLPWLLSWVSATAWRAARSPLLCHSLRKTSSSQGGKSELVKQSLKKPKLPEGRFDAPEDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWE
STMI:                    TTTTTTTTTTTTTTTTTTTT                                                                                
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D..DDDDDDDDDDDDDDDDDDDDD...........................
DO_IUPRED2A:             ............................DDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..
CONSENSUS:                                   DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...
CONSENSUS_MOBI:                              ..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[D]:                                                                          DapeDshlekeplekfpDD                       
RICH_[K]:                                               KtsssqggKselvKqslKKpK                                                
RICH_[S]:                                      SpllchSlrktSSSqggkS                                                           
RICH_[DE]:                                                                         DapEDshlEkEplEkfpDD                       
RICH_[EK]:                                                                                 EKEplEKfpddvnpvtKEK               
RICH_[EP]:                                                                 PklPEgrfdaPEdshlEkEP                              
RICH_[GP]:                                                                                              PvtkekGGPrGPePtryG   
RICH_MOBI_[D]:                                                                     DapeDshlekeplekfpDD                       
RICH_MOBI_[K]:                                          KtsssqggKselvKqslKKpK                                                
RICH_MOBI_[R]:                                                                                                   RgpeptRygdwe
RICH_MOBI_[DE]:                                                                    DapEDshlEkEplEkfpDD                       
RICH_MOBI_[DF]:                                                                   FDapeDshlekeplekFpDD                       
RICH_MOBI_[EF]:                                                                EgrFdapEdshlEkEplEkF                          
RICH_MOBI_[EK]:                                                                            EKEplEKfpddvnpvtKEK               
RICH_MOBI_[GR]:                                                                                               GGpRGpeptRyGdwe
RICH_MOBI_[KL]:                                                 KseLvKqsLKKpKL                                               

                                     
AA:                      RKGRCIDF
STMI:                            
DO_DISOPRED3:            ........
DO_IUPRED2A:             ........
DO_SPOTD:                ..DD.DDD
CONSENSUS:               ........
CONSENSUS_MOBI:          DDDDDDDD
RICH_MOBI_[R]:           RkgR    
RICH_MOBI_[GR]:          RkGR