P0DN24 CC086_HUMAN

Gene name: C3orf86
Protein name: Uncharacterized protein C3orf86

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5W150 n/a 0.90755
2 Q9H9H4 VPS37B 0.85139 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cellular component assembly GO:0022607
...
3 Q92777 SYN2 0.84234 cell-cell signaling GO:0007267
transport GO:0006810
vesicle-mediated transport GO:0016192
4 P50281 MMP14 0.84178 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
5 A0PG75 PLSCR5 0.84144 membrane organization GO:0061024
plasma membrane organization GO:0007009
transport GO:0006810
6 O75880 SCO1 0.84124 catabolic process GO:0009056
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
7 Q8IY18 SMC5 0.84084 cell cycle GO:0007049
cell division GO:0051301
cellular nitrogen compound metabolic process GO:0034641
...
8 Q16613 AANAT 0.84026 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
9 Q96QK8 SMIM14 0.83762 anatomical structure development GO:0048856
embryo development GO:0009790
10 Q8WUM4 PDCD6IP 0.83092 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cell cycle GO:0007049
...

                                           20                  40                  60                  80                 100
AA:                      MSRGQFGQGQEPLDMFFWVNEISGEITYPPQKADAPAVSPESPQKKPPFQPRSVQEAPCSPQGPPAQRPALAPPSKPSLKDSGSRNPCPSAPTWARPKPE
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDD...........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDD........DDD.D..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDD.........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PQ]:                                                         PQkkPPfQPrsvQeaPcsPQgPPaQrP                               
RICH_[AP]:                                                                       APcsPqgPPAqrPAlAPP                          
RICH_[P]:                                            PPqkadaPavsPesPqkkPP  PrsvqeaPcsPqgPPaqrPalaPPskPslkdsgsrnPcPsaP        
RICH_[Q]:                                                           QkkppfQprsvQeapcspQ                                      
RICH_fLPS_[P]:                                                                    PcsPqgPPaqrPalaPPskP                       
RICH_MOBI_[PQ]:                                                    PQkkPPfQPrsvQeaPcsPQgPPaQrP                               
RICH_MOBI_[AP]:                                                                  APcsPqgPPAqrPAlAPP                          
RICH_MOBI_[P]:                                       PPqkadaPavsPesPqkkPP  PrsvqeaPcsPqgPPaqrPalaPPskPslkdsgsrnPcPsaP        
RICH_MOBI_[Q]:                                                      QkkppfQprsvQeapcspQ                                      

                                            
AA:                      E
STMI:                     
DO_DISOPRED3:            D
DO_IUPRED2A:             D
DO_SPOTD:                D
CONSENSUS:               D
CONSENSUS_MOBI:          D