List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell differentiation GO:0030154
- growth GO:0040007
- membrane organization GO:0061024

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q9BT56	SPX	0.99855	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 circulatory system process GO:0003013 ...
2	A8MTB9	CEACAM18	0.98894
3	Q96NB1	CEP20	0.97601	cellular component assembly GO:0022607 cytoskeleton organization GO:0007010
4	Q5XG85	n/a	0.95802
5	Q6QEF8	CORO6	0.94313	cytoskeleton organization GO:0007010
6	Q9NRA2	SLC17A5	0.91922	transport GO:0006810
7	Q9NRC8	SIRT7	0.9029	biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell cycle GO:0007049 ...
8	Q8IYR6	TMEFF1	0.89984	anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ...
9	Q8N7P7	n/a	0.89969
10	Q5VV11	n/a	0.89591

                                           20                  40                  60                  80                
AA:                      MPTPLLPLLLRLLLSCLLLPAARLARQYLLPLLRRLARRLGSQDMREALLGCLLFILSQRHSPDAGEASRVDRLERRERLGPQK
STMI:                                                                                                        
DO_DISOPRED3:            DD...................................................................DDDDDDDDDDDDDDD
DO_IUPRED2A:             ...................................................................DD..DDD.DD.D..DDD
DO_SPOTD:                DD...........................................................DDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DD.................................................................DDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .............................................................DDDDDDDDDDDDDDDDDDDDDDD
RICH_[R]:                                                                                     RvdRleRReR     
RICH_MOBI_[R]:                                                                                RvdRleRReR