Q68G75 LEMD1_HUMAN

Gene name: LEMD1
Protein name: LEM domain-containing protein 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y448 KNSTRN 0.60364 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...
2 P62241 RPS8 0.51505 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 Q9NZ43 USE1 0.50236 catabolic process GO:0009056
protein transport GO:0015031
transport GO:0006810
...
4 P83881 RPL36A 0.47746 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 P61812 TGFB2 0.47453 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
6 Q99578 RIT2 0.46928 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
7 P78369 CLDN10 0.46766 cell adhesion GO:0007155
cell junction organization GO:0034330
cellular component assembly GO:0022607
...
8 Q7Z699 SPRED1 0.45394 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
9 Q8NDQ6 ZNF540 0.45372 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
10 Q9H0A6 RNF32 0.44559

                                           20                  40                  60                  80                 100
AA:                      MVDVKCLSDCKLQNQLEKLGFSPGPILPSTRKLYEKKLVQLLVSPPCAPPVMNGPRELDGAQDSDDSEELNIILQGNIILSTEKSKKLKKWPEASTTKRK
STMI:                                                                                                                        
DO_DISOPRED3:            D..........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .................................................D.DDDDDDDDDDDD...........................D.........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               D..........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[K]:                                                                                                   KsKKlKKwpeasttKrK
RICH_[DI]:                                                                         DgaqDsDDseelnII                           
RICH_[IK]:                                                                                      IIlqgnIIlsteKsKKlKK          
RICH_[IL]:                                                                                    LnIILqgnIILstekskkL            
RICH_[KL]:                                                                                    LniiLqgniiLsteKsKKLK           
RICH_[KY]:                                                                                                                KrK
RICH_fLPS_[D]:                                                                   elDgaqDsDD                                  
RICH_fLPS_[I]:                                                                           ddseelnIIlqgnII                     
RICH_fLPS_[K]:                                                                                           steKsKKlKKwpeasttKrK

                                          120                 140                 160                 180                   
AA:                      AVDTYCLDYKPSKGRRWAARAPSTRITYGTITKERDYCAEDQTIESWREEGFPVGLKLAVLGIFIIVVFVYLTVENKSLFG
STMI:                                                                       MMMMMMMMMMMMMMMMMMMMM         
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................D
DO_IUPRED2A:             .................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...                     ........D
CONSENSUS_MOBI:          ...................................................                     .........
RICH_[AR]:                             RRwAARApstR                                                        
RICH_[RT]:                             RRwaaRapsTRiTygTiTkeR                                              
RICH_[RY]:                       YkpskgRRwaaRapstRitY                                                     
RICH_[R]:                              RRwaaRapstRitygtitkeR                                              
RICH_[T]:                                       TriTygTiTkerdycaedqT                                      
RICH_[Y]:                                           YgtitkerdY                                            
RICH_[TY]:                                      TriTYgTiTkerdYcaedqT                                      
RICH_[KY]:               avdtYcldYKpsK