P62241 RS8_HUMAN
Gene name: RPS8
Protein name: 40S ribosomal protein S8
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- ribosome biogenesis GO:0042254
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5T2T1 | MPP7 | 0.77228 | cell junction organization GO:0034330 cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
| 2 | P62847 | RPS24 | 0.7687 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 3 | P62753 | RPS6 | 0.74462 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 4 | Q8IZU8 | DSEL | 0.7411 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 5 | Q92466 | DDB2 | 0.73941 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 6 | Q9HBE4 | IL21 | 0.7367 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 7 | Q15388 | TOMM20 | 0.7299 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 8 | P16885 | PLCG2 | 0.72573 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | P46777 | RPL5 | 0.68449 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 10 | P0C843 | LINC00032 | 0.67733 |
20 40 60 80 100 AA: MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNC STMI: DO_DISOPRED3: DDDDDDDDDDDDDD.DDDDDD............................................................................... DO_IUPRED2A: .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDD.D................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................. CONSENSUS_MOBI: D................................................................................................... RICH_[RY]: RRktggkRkpYhkkRkYelgR RICH_[K]: KrrKtggKrKpyhKKrKyelgrpaantK RICH_[R]: RdnwhkRRktggkRkpyhkkRkyelgR RICH_[HK]: HKrrKtggKrKpyHK RICH_[KR]: RdnwhKRRKtggKRKpyhKKRKyelgR RICH_[KY]: KrrKtggKrKpYhKKrKYelgrpaantK RICH_fLPS_[K]: nwhKrrKtggKrKpyhKKrK
120 140 160 180 200 AA: IVLIDSTPYRQWYESHYALPLGRKKGAKLTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELEFYLR STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ...............................DDD............DDD................................................... DO_SPOTD: .........................DDD.....DDDDDDDDDDD........................................................ CONSENSUS: .................................D.................................................................. CONSENSUS_MOBI: ....................................................................................................
AA: KIKARKGK STMI: DO_DISOPRED3: .....DDD DO_IUPRED2A: ........ DO_SPOTD: ....DDDD CONSENSUS: .....DDD CONSENSUS_MOBI: ........