Q6EEV6 SUMO4_HUMAN
Gene name: SUMO4
Protein name: Small ubiquitin-related modifier 4
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y243 | AKT3 | 0.89443 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell population proliferation GO:0008283 ... |
| 2 | Q9GZL7 | WDR12 | 0.88492 | cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 ... |
| 3 | Q0VD86 | INCA1 | 0.85166 | cell cycle GO:0007049 cell death GO:0008219 cell population proliferation GO:0008283 ... |
| 4 | P31749 | AKT1 | 0.8165 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q99965 | ADAM2 | 0.81373 | cell adhesion GO:0007155 membrane organization GO:0061024 nervous system process GO:0050877 ... |
| 6 | Q9Y487 | ATP6V0A2 | 0.81044 | catabolic process GO:0009056 homeostatic process GO:0042592 immune system process GO:0002376 ... |
| 7 | Q16342 | PDCD2 | 0.79436 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 8 | O96024 | B3GALT4 | 0.79262 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
| 9 | Q8TAF3 | WDR48 | 0.79162 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell population proliferation GO:0008283 ... |
| 10 | Q8IW40 | CCDC103 | 0.76822 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
20 40 60 80 AA: MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSMKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY STMI: DO_DISOPRED3: DDDDDDDDDDD.................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDD.....................................DD..DDDDDDDDDDDDDDDDDDDDDDD.DDD...... DO_SPOTD: DDDDDDDDDDDDDD................................................................................. CONSENSUS: DDDDDDDDDDDDDD................................................................................. CONSENSUS_MOBI: ............................................................................................... RICH_[E]: EkptEEvktE