Q8IW40 CC103_HUMAN
Gene name: CCDC103
Protein name: Coiled-coil domain-containing protein 103
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- embryo development GO:0009790
- protein-containing complex assembly GO:0065003
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6B0B8 | TIGD3 | 0.9929 | |
| 2 | Q9UBE0 | SAE1 | 0.98361 | cellular protein modification process GO:0006464 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 3 | Q7L945 | ZNF627 | 0.97697 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | Q96J66 | ABCC11 | 0.82897 | transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | Q9ULZ2 | STAP1 | 0.76822 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 6 | Q9UNK0 | STX8 | 0.76822 | immune system process GO:0002376 membrane organization GO:0061024 protein transport GO:0015031 ... |
| 7 | Q9P0R6 | GSKIP | 0.73452 | cell death GO:0008219 cell-cell signaling GO:0007267 cellular protein modification process GO:0006464 ... |
| 8 | Q9NZN4 | EHD2 | 0.72782 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 9 | Q96PE6 | ZIM3 | 0.72442 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | Q5ZPR3 | CD276 | 0.70666 | cell adhesion GO:0007155 cell population proliferation GO:0008283 immune system process GO:0002376 ... |
20 40 60 80 100 AA: MERNDIINFKALEKELQAALTADEKYKRENAAKLRAVEQRVASYEEFRGIVLASHLKPLERKDKMGGKRTVPWNCHTIQGRTFQDVATEISPEKAPLQPE STMI: DO_DISOPRED3: DDDDD........................................................DD........................DDD.......... DO_IUPRED2A: ......................D......................................D.D..D..................D..DDDDDDD..D.. DO_SPOTD: DDDDDD........D...DD..DD.D...D...D..D............DDD..DDDDDDDDDDDDDDDDD.....DD..DDDDDDDDDDDDDDD..... CONSENSUS: DDDDD.................D......................................DDDDDD..................DDDDDDDDDD..... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: TSADFYRDWRRHLPSGPERYQALLQLGGPRLGCLFQTDVGFGLLGELLVALADHVGPADRAAVLGILCSLASTGRFTLNLSLLSRAERESCKGLFQKLQA STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .......DD........................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 AA: MGNPRSVKEGLSWEEQGLEEQSGGLQEEERLLQELLELYQVD STMI: DO_DISOPRED3: ......DDDDDDDDDDDDDDDDDD.................. DO_IUPRED2A: ..........DDDD...DDD...D.................. DO_SPOTD: ...DDDDDDDDDDDDDDDDDDDDD................DD CONSENSUS: ......DDDDDDDDDDDDDDDDDD.................. CONSENSUS_MOBI: .......................................... RICH_[E]: EglswEEqglEE RICH_[EG]: EqGlEEqsGG