Q6NZ36 FAP20_HUMAN

Gene name: FAAP20
Protein name: Fanconi anemia core complex-associated protein 20

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 I0J062 PANO1 0.85472 catabolic process GO:0009056
cell death GO:0008219
2 Q86YD1 PTOV1 0.82194 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 O75161 NPHP4 0.81998 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
4 Q7Z4H4 ADM2 0.8188 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cellular protein modification process GO:0006464
...
5 A0A1B0GVG4 CCDC194 0.81453
6 Q8TAI1 TYMSOS 0.79567
7 A8MTW9 n/a 0.795
8 Q69YZ2 TMEM200B 0.79344
9 A0PJZ3 GXYLT2 0.7893 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
10 P59051 BRWD1-AS2 0.78844

                                           20                  40                  60                  80                 100
AA:                      MEAARRPRLGLSRRRPRPAGGPSGGRPWFLLGGDERERLWAELLRTVSPELILDHEVPSLPAFPGQEPRCGPEPTEVFTVGPKTFSWTPFPPDLWGPGRS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................DDDDDDDDDDDDDDDDD.................DDDDDDDDD
DO_IUPRED2A:             ...DDDDDDDDDDDDDDDDDDDDDDDDDD.........................DDDDD..DDDDDDDDDDDDDDDDDD.DDD.....D...........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................
RICH_[PR]:                   RRPRlglsRRRPRPaggPsggRP                                                                         
RICH_[G]:                                                                                                               GpGrs
RICH_[P]:                                                                         PslPafPgqePrcgPeP                          
RICH_[R]:                    RRpRlglsRRRpRpaggpsggR                                                                          
RICH_[GH]:                                                                                                              GpGrs
RICH_[GL]:                                                                                                            LwGpGrs
RICH_[GP]:                     PrlGlsrrrPrPaGGPsGGrP                                                             PfPPdlwGPGrs
RICH_[GR]:                   RRpRlGlsRRRpRpaGGpsGGR                                                                          
RICH_fLPS_[R]:             aaRRpRlglsRRRpRpaggpsggR                                                                          
RICH_MOBI_[R]:               RRpRlglsRRRpRpaggpsggR                                                                          
RICH_MOBI_[GR]:              RRpRlGlsRRRpRpaGGpsGGR                                                                          
RICH_fLPS_MOBI_[R]:        aaRRpRlglsRRRpRpaggpsggR                                                                          

                                          120                 140                 160
AA:                      YRLLHGAGGHLESPARSLPQRPAPDPCRAPRVEQQPSVEGAAALRSCPMCQKEFAPRLTQLDVDSHLAQCLAESTEDVTW
STMI:                                                                                                    
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................D
DO_IUPRED2A:             .....DD..D.DDDDDDDDDDDDDDDDDDDDDDDDD.DD...D.........................D...........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................DDDDD.
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................
CONSENSUS_MOBI:          .....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
RICH_[PR]:                            PaRslPqRPaPdPcRaPR                                                 
RICH_[AP]:                                     APdPcrAPrveqqPsvegAAA                                     
RICH_[G]:                yrllhGaGG                                                                       
RICH_[P]:                             ParslPqrPaPdPcraP                                                  
RICH_[R]:                               RslpqRpapdpcRapR                                                 
RICH_[GH]:               yrllHGaGGH                                                                      
RICH_[GL]:               yrLLhGaGGhL                                                                     
RICH_[GP]:               yrllhGaG                                                                        
RICH_MOBI_[PR]:                       PaRslPqRPaPdPcRaPR                                                 
RICH_MOBI_[P]:                        ParslPqrPaPdPcraP                                                  
RICH_MOBI_[R]:                          RslpqRpapdpcRapR