Q6NZ67 MZT2B_HUMAN

Gene name: MZT2B
Protein name: Mitotic-spindle organizing protein 2B

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6P582 MZT2A 0.97248
2 A1A5C7 SLC22A23 0.73341 transport GO:0006810
3 O60548 FOXD2 0.73015 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
4 Q9UD57 NKX1-2 0.72818 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
5 Q92925 SMARCD2 0.72376 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
6 P52824 DGKQ 0.71806 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cellular nitrogen compound metabolic process GO:0034641
...
7 Q96J87 CELF6 0.71052 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
...
8 O14904 WNT9A 0.70789 anatomical structure development GO:0048856
cell cycle GO:0007049
cell death GO:0008219
...
9 P0CJ88 DUX4L5 0.70281 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
10 P0CJ86 DUX4L3 0.70011 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDD....................................................................DDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDD......................D.....................................DDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDD...........................................................DDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDD............................................................DDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...................................................................................DDDDDDDDDDDDDDDDD
RICH_[AG]:                AAqGvGpGpGsAAppGleAA                                                                               
RICH_[AP]:                AAqgvgPgPgsAAPPgleAA                                                                               
RICH_[A]:                 AAqgvgpgpgsAAppgleAA                                                                               
RICH_[G]:                    GvGpGpGsaappG                                                                                   
RICH_[GP]:                   GvGPGPGsaaPPG                                                                                   

                                          120                 140  
AA:                      SVPETRGRNKGSAALGGALALAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST
STMI:                                                                              
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AG]:                     GrnkGsAAlGGAlAlA                                    
RICH_[AL]:                           AALggALALA                                    
RICH_[A]:                            AAlggAlAlA                                    
RICH_[RS]:                                      RSSRegSSqR                         
RICH_[G]:                                                             GGGpGksptrG  
RICH_[R]:                                       RssRegssqRmpRqpsatR                
RICH_[GP]:                                                 PrqPsatrlPkGGGPGksPtrG  
RICH_fLPS_[A]:                       AAlggAlAlA                                    
RICH_MOBI_[AG]:                GrnkGsAAlGGAlAlA                                    
RICH_MOBI_[AL]:                      AALggALALA                                    
RICH_MOBI_[A]:                       AAlggAlAlA                                    
RICH_MOBI_[RS]:                                 RSSRegSSqR                         
RICH_MOBI_[G]:                                                        GGGpGksptrG  
RICH_MOBI_[R]:                                  RssRegssqRmpRqpsatR