Q6P582 MZT2A_HUMAN

Gene name: MZT2A
Protein name: Mitotic-spindle organizing protein 2A

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6NZ67 MZT2B 0.97248
2 A1A5C7 SLC22A23 0.75417 transport GO:0006810
3 Q9UD57 NKX1-2 0.73848 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
4 P52824 DGKQ 0.73838 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cellular nitrogen compound metabolic process GO:0034641
...
5 Q92925 SMARCD2 0.73091 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
6 Q96J87 CELF6 0.73062 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
...
7 O14904 WNT9A 0.72792 anatomical structure development GO:0048856
cell cycle GO:0007049
cell death GO:0008219
...
8 O60548 FOXD2 0.72565 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
9 Q15270 NKX1-1 0.71677 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cell differentiation GO:0030154
...
10 Q9BX95 SGPP1 0.71293 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...

                                           20                  40                  60                  80                 100
AA:                      MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGGIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDD..................................................................DDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDD......................D.....................................DDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDD..........................................................DDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDD............................................................DDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...................................................................................DDDDDDDDDDDDDDDDD
RICH_[AG]:                AAqGvGpGpGsAAppGleAA                                                                               
RICH_[AP]:                AAqgvgPgPgsAAPPgleAA                                                                               
RICH_[A]:                 AAqgvgpgpgsAAppgleAA                                                                               
RICH_[G]:                    GvGpGpGsaappG                                                                                   
RICH_[GP]:                   GvGPGPGsaaPPG                                                                                   

                                          120                 140  
AA:                      SVPETRGRDKGSAALGGVLALAERSNHEGSSQRMPRQPSATRLPKGGGPGKSPTQGST
STMI:                                                                              
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AG]:                     GrdkGsAAlGGvlAlA                                    
RICH_[AL]:                           AALggvLALA                                    
RICH_[A]:                            AAlggvlAlA                                    
RICH_[G]:                                                             GGGpGksptqG  
RICH_[R]:                                       RsnhegssqRmpRqpsatR                
RICH_[GP]:                                                 PrqPsatrlPkGGGPGksPtqG  
RICH_MOBI_[AG]:                GrdkGsAAlGGvlAlA                                    
RICH_MOBI_[AL]:                      AALggvLALA                                    
RICH_MOBI_[A]:                       AAlggvlAlA                                    
RICH_MOBI_[G]:                                                        GGGpGksptqG  
RICH_MOBI_[R]:                                  RsnhegssqRmpRqpsatR