Q6P1K2 PMF1_HUMAN
Gene name: PMF1
Protein name: Polyamine-modulated factor 1
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cell division GO:0051301
- cellular nitrogen compound metabolic process GO:0034641
- chromosome segregation GO:0007059
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P41227 | NAA10 | 0.70199 | cell cycle GO:0007049 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 2 | Q05996 | ZP2 | 0.69434 | reproduction GO:0000003 |
| 3 | Q7Z2X4 | PID1 | 0.69372 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 4 | Q9H825 | METTL8 | 0.65696 | |
| 5 | Q9P2W9 | STX18 | 0.64668 | cellular component assembly GO:0022607 membrane organization GO:0061024 protein transport GO:0015031 ... |
| 6 | P43362 | MAGEA9 | 0.64631 | |
| 7 | A8MW99 | MEI4 | 0.64366 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 8 | O43353 | RIPK2 | 0.6407 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | Q8WVD5 | RNF141 | 0.63914 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
| 10 | Q6UWL6 | KIRREL2 | 0.62869 | cell adhesion GO:0007155 cellular protein modification process GO:0006464 |
20 40 60 80 100 AA: MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGN STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... DO_IUPRED2A: ........DDDDDDDDDDDDDDDDDDDDDD...................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... RICH_[S]: SSanlgSgceekrhegSSSeS RICH_[EG]: GsGcEEkrhEGsssEsvppG RICH_[ES]: SSanlgSgcEEkrhEgSSSES RICH_MOBI_[EG]: GsGcEEkrhEGsssEsvppG RICH_MOBI_[ES]: SSanlgSgcEEkrhEgSSSES
120 140 160 180 200 AA: LEAVLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQALHREQRELVAV STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ..................D..DDDD..DD.......................DDD............................................. DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: LREPE STMI: DO_DISOPRED3: ...DD DO_IUPRED2A: ..... DO_SPOTD: DDDDD CONSENSUS: ...DD CONSENSUS_MOBI: ...DD