Q6PJE2 POZP3_HUMAN
Gene name: POMZP3
Protein name: POM121 and ZP3 fusion protein
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- reproduction GO:0000003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P41586 | ADCYAP1R1 | 0.87713 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 2 | Q9H7T0 | CATSPERB | 0.8351 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 3 | Q8TCS8 | PNPT1 | 0.8351 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell cycle GO:0007049 ... |
| 4 | P15907 | ST6GAL1 | 0.79426 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 5 | Q7Z7C7 | STRA8 | 0.78997 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 6 | Q9UHX3 | ADGRE2 | 0.78031 | cell adhesion GO:0007155 immune system process GO:0002376 response to stress GO:0006950 ... |
| 7 | Q9NUX5 | POT1 | 0.78031 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | Q9BY15 | ADGRE3 | 0.78031 | immune system process GO:0002376 signal transduction GO:0007165 transport GO:0006810 ... |
| 9 | Q8N699 | MYCT1 | 0.76483 | |
| 10 | C9JLW8 | MCRIP1 | 0.75116 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
20 40 60 80 100 AA: MVCSPVTLRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKKRTVEEEDQIFLDGQENKRSCLVDGLTDASSAFKVPRPGPDTLQ STMI: DO_DISOPRED3: D..............DDDDDDDDDDDDDDDDDDDDDDDDD......................DD.................................... DO_IUPRED2A: .............DD............DDDDDDDDDDDDD.DDD........DDD......DDDDD.....................DDD.......... DO_SPOTD: ...............DDDDDDDDDDDDDDDDDDDDDDDD......DDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............... CONSENSUS: ...............DDDDDDDDDDDDDDDDDDDDDDDDD............DDD......DDDDD.................................. CONSENSUS_MOBI: .................................................................................................... RICH_[S]: SrSaipeqiiSStlSSpSS RICH_[IS]: SrSaIpeqIISStlSSpSS RICH_fLPS_[S]: iSStlSSpSS
120 140 160 180 AA: FTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEGLADICQCCNKGDCGTPSHSRRQPRVVSQWSTSASL STMI: DO_DISOPRED3: ...................................................................DDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ......................................................................D.D..DD.......... DO_SPOTD: ..............................................................DDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...................................................................DDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................................DDDDDDDDDDDDDDDDDDDDDD RICH_[S]: ShSrrqprvvSqwStSaS RICH_MOBI_[SV]: VVSqwStSaS