Q6Q795 VBPC1_HUMAN

Protein name: Putative viral protein-binding protein C1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6ZUU3 FOXL2NB 0.71029
2 Q96HZ7 URB1-AS1 0.6791
3 P59051 BRWD1-AS2 0.67589
4 Q5T036 FAM120AOS 0.67532
5 A0A096LP49 CCDC187 0.6455 cytoskeleton organization GO:0007010
6 Q7Z6J4 FGD2 0.64549 anatomical structure development GO:0048856
cell death GO:0008219
cell morphogenesis GO:0000902
...
7 Q15560 TCEA2 0.64424 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
8 Q9H2D6 TRIOBP 0.64336 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell cycle GO:0007049
...
9 Q9Y3Z3 SAMHD1 0.64283 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
10 Q8N1I8 CACTIN-AS1 0.63078

                                           20                  40                  60                  80                 100
AA:                      MEEVIQAGLAQWSRQKGLALPWDRTRGHPDVPWRNLTSSPTRPLAQPAGSCMPAEPSPAAHYHQLHVHLQLLPSDLSERPGLRLAPLALVEVGMTLPVPQ
STMI:                                                                                                                        
DO_DISOPRED3:            DDDD................................................................................................
DO_IUPRED2A:             ...................DDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................DDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDD...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................DDD
CONSENSUS_MOBI:          ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................
RICH_[PQ]:                                                                                                                 PQ
RICH_[PR]:                                      RtRghPdvPwRnltssPtRP                                                         
RICH_[PW]:                                   PWdrtrghPdvPWrnltssP                                                            
RICH_[P]:                                                       PtrPlaqPagscmPaePsP                                          
RICH_[Q]:                                                                                                                   Q
RICH_[R]:                                       RtRghpdvpwRnltssptR                                                          
RICH_[W]:                                     WdrtrghpdvpW                                                                   
RICH_MOBI_[R]:                                  RtRghpdvpwRnltssptR                                                          
RICH_MOBI_[W]:                                WdrtrghpdvpW                                                                   

                                          120                   
AA:                      TPLPHVTQQQKLAPGRQLCPW
STMI:                                         
DO_DISOPRED3:            .....................
DO_IUPRED2A:             DDDDDDDDDDDD.D..D....
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDD....
CONSENSUS_MOBI:          .....................
RICH_[PQ]:               tPlPhvtQQQklaPgrQ    
RICH_[Q]:                tplphvtQQQklapgrQ