Q96HZ7 URAS1_HUMAN

Gene name: URB1-AS1
Protein name: Putative uncharacterized protein URB1-AS1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5T036 FAM120AOS 0.99235
2 Q9Y3Z3 SAMHD1 0.95637 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
3 O75078 ADAM11 0.92377 signal transduction GO:0007165
4 Q15116 PDCD1 0.91603 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
5 Q6ZUU3 FOXL2NB 0.89301
6 Q9NRA2 SLC17A5 0.88916 transport GO:0006810
7 Q9NRC8 SIRT7 0.88808 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cell cycle GO:0007049
...
8 Q6QEF8 CORO6 0.88787 cytoskeleton organization GO:0007010
9 Q7Z6J4 FGD2 0.88648 anatomical structure development GO:0048856
cell death GO:0008219
cell morphogenesis GO:0000902
...
10 Q5XG85 n/a 0.88449

                                           20                  40                  60                   
AA:                      MGRADTPRHPPPPAAGFGVHRGAFLIPVALRVLLAGRTPRPFTPGLADPRRLGPRRVQAAQ
STMI:                                                                                 
DO_DISOPRED3:            DDDDDDDDD...................................................D
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDD....................DDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDD.....................DDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDD.....................DDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .....................................DDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PR]:                                                      RPftPgladPRRlgPRR     
RICH_[R]:                                                       RpftpgladpRRlgpRR     
RICH_MOBI_[R]:                                                  RpftpgladpRRlgpRR