Q6RSH7 VHLL_HUMAN
Gene name: VHLL
Protein name: von Hippel-Lindau-like protein
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5JT25 | RAB41 | 0.83604 | protein transport GO:0015031 signal transduction GO:0007165 transport GO:0006810 ... |
| 2 | Q96J66 | ABCC11 | 0.71947 | transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | O43681 | GET3 | 0.71893 | membrane organization GO:0061024 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 4 | P07437 | TUBB | 0.71412 | cell cycle GO:0007049 cell division GO:0051301 cell junction organization GO:0034330 ... |
| 5 | P04350 | TUBB4A | 0.71091 | cell cycle GO:0007049 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 6 | Q16543 | CDC37 | 0.70497 | catabolic process GO:0009056 cell cycle GO:0007049 cellular protein modification process GO:0006464 ... |
| 7 | P08833 | IGFBP1 | 0.69936 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 cellular protein modification process GO:0006464 ... |
| 8 | Q9NRD5 | PICK1 | 0.69008 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ... |
| 9 | Q9NZJ6 | COQ3 | 0.65998 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
| 10 | Q9UPT9 | USP22 | 0.65947 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MPWRAGNGVGLEAQAGTQEAGPEEYCQEELGAEEEMAARAAWPVLRSVNSRELSRIIICNHSPRIVLPVWLNYYGKLLPYLTLLPGRDFRIHNFRSHPWL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................... DO_IUPRED2A: ...........DDDDDDDDDDDDDDDDDD....................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. RICH_[AE]: AgngvglEAqAgtqEAgpEE ElgAEEEmAArA RICH_[AG]: AGnGvGleAqAGtqeAG RICH_[E]: EaqagtqEagpEEycqEElgaEEE RICH_[EG]: GnGvGlEaqaGtqEaGpEE RICH_fLPS_[E]: gtqEagpEEycqEElgaEEE RICH_MOBI_[AG]: AGnGvGleAqAGtqeAG
120 AA: FRDARTHDKLLVNQTELFVPSSNVNGQPVFANITLQCIP STMI: DO_DISOPRED3: ....................................... DO_IUPRED2A: ....................................... DO_SPOTD: ....................................... CONSENSUS: ....................................... CONSENSUS_MOBI: .......................................