P08833 IBP1_HUMAN
Gene name: IGFBP1
Protein name: Insulin-like growth factor-binding protein 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell-cell signaling GO:0007267
- cellular protein modification process GO:0006464
- growth GO:0040007
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P07437 | TUBB | 0.95146 | cell cycle GO:0007049 cell division GO:0051301 cell junction organization GO:0034330 ... |
| 2 | P04350 | TUBB4A | 0.94855 | cell cycle GO:0007049 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 3 | Q8ND90 | PNMA1 | 0.79494 | cell death GO:0008219 immune system process GO:0002376 response to stress GO:0006950 |
| 4 | P42857 | NSG1 | 0.7612 | cell death GO:0008219 cell-cell signaling GO:0007267 cellular component assembly GO:0022607 ... |
| 5 | Q07817 | BCL2L1 | 0.7609 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
| 6 | Q9UI26 | IPO11 | 0.76041 | nucleocytoplasmic transport GO:0006913 protein transport GO:0015031 transport GO:0006810 |
| 7 | Q86XI2 | NCAPG2 | 0.75982 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 8 | P55064 | AQP5 | 0.75874 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 ... |
| 9 | Q9UKJ5 | CHIC2 | 0.75874 | |
| 10 | Q9UPT9 | USP22 | 0.75874 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRG STMI: SSSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDD............DD.DDDDDDDDDDDDDDDDDD.D..........DDD.............DDDDDDDDDDDDDDD CONSENSUS: ........................................................................... CONSENSUS_MOBI: ...........................................................................
120 140 160 180 200 AA: QGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISK STMI: DO_DISOPRED3: .....................................................D.DDDDDDDDDDDDDDDDDD........................... DO_IUPRED2A: ...........D.DDDDDDDDDDDDDDDDDDDDD..DD.............................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................. CONSENSUS: ...........DDDDDDDDDDDDDDDDDDDDDDDDDDD...............D.DDDDDDDDDDDDDDDD............................. CONSENSUS_MOBI: .................................................................DDDDDD............................. RICH_[AE]: AphAAEAgspEspEstEitE RICH_[E]: EagspEspEstEitEEE RICH_fLPS_[E]: haaEagspEspEstEitEEE
220 240 AA: FYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN STMI: DO_DISOPRED3: ................................................DDDDDDDDDDD DO_IUPRED2A: ........................................................... DO_SPOTD: .........................................DDDDDDDDDDDDDDDDDD CONSENSUS: ................................................DDDDDDDDDDD CONSENSUS_MOBI: ........................................................DDD RICH_[N]: NcqiyfNvqN