Q6UX98 ZDH24_HUMAN
Gene name: ZDHHC24
Protein name: Probable palmitoyltransferase ZDHHC24
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular protein modification process GO:0006464
- protein targeting GO:0006605
- protein transport GO:0015031
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q7Z4R8 | C6orf120 | 0.86193 | cell death GO:0008219 immune system process GO:0002376 transport GO:0006810 ... |
| 2 | Q8N653 | LZTR1 | 0.848 | anatomical structure development GO:0048856 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 3 | Q9C029 | TRIM7 | 0.8155 | cellular protein modification process GO:0006464 |
| 4 | P55058 | PLTP | 0.8064 | biosynthetic process GO:0009058 reproduction GO:0000003 small molecule metabolic process GO:0044281 ... |
| 5 | Q96QD5 | DEPDC7 | 0.80506 | signal transduction GO:0007165 |
| 6 | P81605 | DCD | 0.78849 | biological process involved in symbiotic interaction GO:0044403 immune system process GO:0002376 response to stress GO:0006950 |
| 7 | O75503 | CLN5 | 0.78488 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 8 | O15212 | PFDN6 | 0.76822 | cellular component assembly GO:0022607 protein folding GO:0006457 protein-containing complex assembly GO:0065003 |
| 9 | P51854 | TKTL1 | 0.76339 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q9H0T7 | RAB17 | 0.72701 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ... |
20 40 60 80 100 AA: MGQPWAAGSTDGAPAQLPLVLTALWAAAVGLELAYVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRSDPSIRGVMLAGRGLGQGWAYCYQCQ STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDD.D..DDDDDDDDD............................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDD...DDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDD ............. ........................... CONSENSUS_MOBI: .................. ............. ........................... RICH_[A]: AAgstdgApA
120 140 160 180 200 AA: SQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFGNYRPFLCLLLHAAGVLLHVSVLLGPALSALLRAHTPLHMAALLLLPWLMLLTGRVSLAQFALAFVT STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ..................................... ........ ............. CONSENSUS_MOBI: ..................................... ........ .............
220 240 260 280 AA: DTCVAGALLCGAGLLFHGMLLLRGQTTWEWARGQHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTAS STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...............................................................................DDDDD DO_IUPRED2A: .................................................................................... DO_SPOTD: .............................................................................DDDDDDD CONSENSUS: . .........................................................DDDDD CONSENSUS_MOBI: . ..............................................................