P81605 DCD_HUMAN

Gene name: DCD
Protein name: Dermcidin

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- immune system process GO:0002376
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q3LXA3 TKFC 0.97284 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
immune system process GO:0002376
...
2 Q9NQT5 EXOSC3 0.94913 anatomical structure development GO:0048856
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
3 Q96G91 P2RY11 0.92373 response to stress GO:0006950
signal transduction GO:0007165
4 P06396 GSN 0.80056 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
cell adhesion GO:0007155
...
5 Q9Y2S7 POLDIP2 0.78849 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
6 Q9Y233 PDE10A 0.78849 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
7 Q9Y5Z4 HEBP2 0.78849 cell death GO:0008219
immune system process GO:0002376
membrane organization GO:0061024
...
8 P25090 FPR2 0.75816 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
9 O15503 INSIG1 0.75642 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
10 Q99536 VAT1 0.73029 anatomical structure development GO:0048856
immune system process GO:0002376
transport GO:0006810
...

                                           20                  40                  60                  80                 100
AA:                      MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVH
STMI:                    SSSSSSSSSSSSSSSSSSS                                                                                 
DO_DISOPRED3:            DDDDDDDDDDDD..............DDDDDDDDDDDDDDDDDDDD......................................................
DO_IUPRED2A:             ..........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................D......
DO_SPOTD:                DD.................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................
CONSENSUS:                                  .......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................
CONSENSUS_MOBI:                             ....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................
RICH_[A]:                                                    AsAAqkenAgedpglArqA                                             
RICH_MOBI_[A]:                                  AAsApgsgnpcheAsAA                                                            

                                   
AA:                      DVKDVLDSVL
STMI:                              
DO_DISOPRED3:            ..........
DO_IUPRED2A:             ..........
DO_SPOTD:                .......DDD
CONSENSUS:               ..........
CONSENSUS_MOBI:          ..........