Q6UXB2 CXL17_HUMAN

Gene name: CXCL17
Protein name: C-X-C motif chemokine 17

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell differentiation GO:0030154
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P17025 ZNF182 0.65688 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 Q9NZC4 EHF 0.63735 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
3 Q8IVC4 ZNF584 0.58328 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 Q15053 KIAA0040 0.56876
5 Q6UVM3 KCNT2 0.56153 transmembrane transport GO:0055085
transport GO:0006810
6 Q6ZSB9 ZBTB49 0.55915 biosynthetic process GO:0009058
cell cycle GO:0007049
cell population proliferation GO:0008283
...
7 Q9H7Z3 NRDE2 0.54658 catabolic process GO:0009056
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
8 Q5T681 C10orf62 0.54042
9 Q9BZW7 TSGA10 0.51477 cellular component assembly GO:0022607
reproduction GO:0000003
10 Q9HAH1 ZNF556 0.51272

                                           20                  40                  60                  80                 100
AA:                      MKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHS
STMI:                    SSSSSSSSSSSSSSSSSSSSS                                                                               
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDD.DDDD......D..........................................................D.DD.D.....
DO_IUPRED2A:             .........................DDDDDDDDDDDDDDDD.......................................DDDDDDDDDDDDDDDDDDD.
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..
CONSENSUS:                                    DDDDDDDDDDDDDDDDDDDD.......................................DDDDDDDDDDDDDDDDDD..
CONSENSUS_MOBI:                               ...........................................................DDDDDDDDDDDDDDDDDDDD
RICH_[R]:                                             RghRdRgqasRR                                                           
RICH_[GR]:                                         GvaRGhRdRG                                                                
RICH_MOBI_[H]:                                                                                                   HqrHHrkpnkH 
RICH_MOBI_[K]:                                                                                           KgnvKKtrhqrhhrKpnK  
RICH_MOBI_[HK]:                                                                                          KgnvKKtrHqrHHrKpnKH 
RICH_fLPS_MOBI_[H]:                                                                                      kgnvkktrHqrHHrkpnkHs

                          
AA:                      RACQQFLKQCQLRSFALPL
STMI:                                       
DO_DISOPRED3:            ...................
DO_IUPRED2A:             ...................
DO_SPOTD:                .............DDDDDD
CONSENSUS:               ...................
CONSENSUS_MOBI:          ...................