Q6UXR6 YI004_HUMAN
Gene name: UNQ6494/PRO21346
Protein name: Putative uncharacterized protein UNQ6494/PRO21346
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O43909 | EXTL3 | 0.60427 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 growth GO:0040007 ... |
| 2 | Q96JB5 | CDK5RAP3 | 0.60068 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 3 | Q9BSN7 | TMEM204 | 0.58419 | anatomical structure development GO:0048856 cell differentiation GO:0030154 signal transduction GO:0007165 |
| 4 | Q9UNA3 | A4GNT | 0.58419 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell population proliferation GO:0008283 ... |
| 5 | Q9BR61 | ACBD6 | 0.57311 | cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 6 | O14944 | EREG | 0.54246 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 7 | Q9NRX5 | SERINC1 | 0.53748 | biosynthetic process GO:0009058 |
| 8 | Q9H223 | EHD4 | 0.52252 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 protein-containing complex assembly GO:0065003 ... |
| 9 | P53621 | COPA | 0.51955 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 10 | Q13217 | DNAJC3 | 0.51628 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
20 40 60 80 100 AA: MQCWQQPFLRFLQQPFFLATASLAGSSSSFNVLIPKRDEDGDGEGPGDVTAGVSRAAGSPSGWEAPWVQQPRCCRRATPVCCAGQGPPRSLQQGGSEVLL STMI: SSSSSSSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: ................................DDDDDDDDDDDDDDDDDDDDDDDDD..DDD......................DDDD...DD..DDDD. DO_SPOTD: DDDDD.D......DDDDDDDDDDDDDD.........DDDDDDDDDDDDDDDDDDDDDDDDD....................................... CONSENSUS: .......DDDDDDDDDDDDDDDDDDDDDDDDD....................................... CONSENSUS_MOBI: ....................................................................... RICH_[D]: DeDgDgegpgD RICH_[G]: GdGeGpGdvtaGvsraaG RICH_[DG]: DeDGDGeGpGDvtaG
120 140 160 180 AA: GQLCSPEPDWLPSSGPKVAKQVFQVAAELLQHPEHFVPSSVPEGCVHKPGSTCDGSLKGRAYPSCVPKRDPEHSREESHPLSG STMI: DO_DISOPRED3: ......................................................................DDDDDDDDDDDDD DO_IUPRED2A: ..........DD..DDDD...DDDD.......DD.....DDD.....................DDDDDDDDDDDDDDDDDDDD DO_SPOTD: .......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .......................................DDD.....................DDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[C]: CdgslkgraypsC