O14944 EREG_HUMAN
Gene name: EREG
Protein name: Proepiregulin [Cleaved into: Epiregulin
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cell division GO:0051301
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- developmental maturation GO:0021700
- growth GO:0040007
- immune system process GO:0002376
- membrane organization GO:0061024
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P26012 | ITGB8 | 0.75118 | |
| 2 | Q14114 | LRP8 | 0.7306 | |
| 3 | P55345 | PRMT2 | 0.62062 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 4 | Q9NZ08 | ERAP1 | 0.56047 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 5 | P28799 | GRN | 0.54643 | |
| 6 | Q6UXR6 | UNQ6494/PRO21346 | 0.54246 | |
| 7 | Q9Y5W5 | WIF1 | 0.53651 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 8 | Q9Y2I2 | NTNG1 | 0.52748 | |
| 9 | Q05823 | RNASEL | 0.52689 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 10 | P58512 | LINC01547 | 0.50109 |
20 40 60 80 100 AA: MTAGRRMEMLCAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTG STMI: SSSSSSSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDD.D.DD...DDDDD.........D.................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................... CONSENSUS: .DDDDDDDDDD.........D.................................................. CONSENSUS_MOBI: ........DDDDDDDDDDDDDDDDDDDDDDDDD...................................... RICH_MOBI_[C]: CipgessdnC
120 140 160 AA: VRCEHFFLTVHQPLSKEYVALTVILIILFLITVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .........................D.........................DDDDDDDDDDDDDDDDDD DO_IUPRED2A: .....................................................DDDDD........... DO_SPOTD: ............................................DDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ................... ...........DDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..........DDDDDD... .............................