Q6ZNB5 TRC2L_HUMAN
Protein name: Putative short transient receptor potential channel 2-like protein
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BXM9 | FSD1L | 0.8591 | |
| 2 | Q96MM3 | ZFP42 | 0.80569 | anatomical structure development GO:0048856 cell cycle GO:0007049 reproduction GO:0000003 |
| 3 | Q68D42 | TMEM215 | 0.79796 | |
| 4 | Q15113 | PCOLCE | 0.68294 | anatomical structure development GO:0048856 |
| 5 | O15266 | SHOX | 0.67069 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q9UQM7 | CAMK2A | 0.65479 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 7 | Q13616 | CUL1 | 0.65205 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
| 8 | Q96DY2 | IQCD | 0.65093 | |
| 9 | Q8TF65 | GIPC2 | 0.62325 | |
| 10 | H3BMG3 | SMKR1 | 0.61966 |
20 40 60 80 100 AA: MAPVKISHVVSFSSQDPKYPVENLLNPDSPRRPWLGCPQDKSGQLKVELQLERAVPTGYIDVGNCGCAFLQIDVGHSSWPLDRPFITLLPATTLMSLTDS STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: ...................DDDDDDD...DDDDDDDDD.........D................................................DDDD DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ..................................................................................................DD
120 140 AA: KQGKNRSGVRMFKDGKEGKSRKDGGGLYEKQRCSTKEDCECY STMI: DO_DISOPRED3: .......................................... DO_IUPRED2A: D...DDDDDDDDDDDDD..DDDDDD.DD.............. DO_SPOTD: ...............DDDDDDDD................... CONSENSUS: ...............DDDDDDDD................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDD.............. RICH_MOBI_[G]: GvrmfkdGkeGksrkdGGG RICH_MOBI_[K]: KqgKnrsgvrmfKdgKegKsrK RICH_MOBI_[GK]: KqGKnrsGvrmfKdGKeGKsrKdGG