H3BMG3 SMKR1_HUMAN

Gene name: SMKR1
Protein name: Small lysine-rich protein 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A6NIV6 LRRIQ4 0.92248
2 P61247 RPS3A 0.916 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 O95995 GAS8 0.87641 anatomical structure development GO:0048856
cell population proliferation GO:0008283
cellular component assembly GO:0022607
...
4 O00585 CCL21 0.86107 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
5 Q15291 RBBP5 0.85918 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
6 Q8TF65 GIPC2 0.84342
7 Q96DY2 IQCD 0.83197
8 Q96MM3 ZFP42 0.82552 anatomical structure development GO:0048856
cell cycle GO:0007049
reproduction GO:0000003
9 O60519 CREBL2 0.82321 biosynthetic process GO:0009058
cell cycle GO:0007049
cell differentiation GO:0030154
...
10 Q9Y291 MRPS33 0.82156 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412

                                           20                  40                  60               
AA:                      MPAKGKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHLRGFHWPGAPKGKKGRSK
STMI:                                                                                     
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDD.....................................DDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDD...........................DDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDD...............................DDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDD...............................DDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDD.........................................
RICH_[G]:                    GkkGkGqGkshG                                                 
RICH_[K]:                   KgKKgKgqgKshgKKqKK                                            
RICH_[GK]:                  KGKKGKGqGKshGKKqKK                                 GapKGKKGrsK
RICH_fLPS_[K]:            paKgKKgKgqgKshgKKqKK                                            
RICH_MOBI_[G]:               GkkGkGqGkshG                                                 
RICH_MOBI_[K]:              KgKKgKgqgKshgKKqKK                                            
RICH_MOBI_[GK]:             KGKKGKGqGKshGKKqKK                                            
RICH_fLPS_MOBI_[K]:       paKgKKgKgqgKshgKKqKK