Q6ZS82 R9BP_HUMAN
Gene name: RGS9BP
Protein name: Regulator of G-protein signaling 9-binding protein
List of terms from Generic GO subset, which this protein is a part of:
- nervous system process GO:0050877
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P25024 | CXCR1 | 0.64124 | homeostatic process GO:0042592 immune system process GO:0002376 signal transduction GO:0007165 ... |
| 2 | Q86XQ3 | CATSPER3 | 0.61335 | anatomical structure development GO:0048856 cell differentiation GO:0030154 developmental maturation GO:0021700 ... |
| 3 | O95989 | NUDT3 | 0.53367 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell-cell signaling GO:0007267 ... |
| 4 | Q01959 | SLC6A3 | 0.52541 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | Q9ULD0 | OGDHL | 0.49614 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | P35900 | KRT20 | 0.48105 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 7 | P03999 | OPN1SW | 0.4191 | cellular protein modification process GO:0006464 nervous system process GO:0050877 signal transduction GO:0007165 |
| 8 | Q13115 | DUSP4 | 0.40426 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cellular protein modification process GO:0006464 ... |
| 9 | Q9C0K7 | STRADB | 0.37559 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell death GO:0008219 ... |
| 10 | Q6WBX8 | RAD9B | 0.34461 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MAREECKALLDGLNKTTACYHHLVLTVGGSADSQNLRQELQKTRQKAQELAVSTCARLTAVLRDRGLAADERAEFERLWVAFSGCLDLLEADMRRALELG STMI: DO_DISOPRED3: DD.................................................................................................. DO_IUPRED2A: ...................................DDDDDD........................................................... DO_SPOTD: DD.................................................................................................. CONSENSUS: DD.................................................................................................. CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: AAFPLHAPRRPLVRTGVAGASSGVAARALSTRSLRLEAEGDFDVADLRELEREVLQVGEMIDNMEMKVNVPRWTVQARQAAGAELLSTVSAGPSSVVSLQ STMI: DO_DISOPRED3: ...................................................................................DDDDDDDDDDDDDDDD. DO_IUPRED2A: ...................................................................................................D DO_SPOTD: .....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...................................................................................DDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................................................................... RICH_[SV]: StVSagpSSVVS
220 AA: ERGGGCDPRKALAAILFGAVLLAAVALAVCVAKLS STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ..................DDDDD.DDDDD....D. DO_IUPRED2A: ................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .......... ..D. CONSENSUS_MOBI: .......... ....