O95989 NUDT3_HUMAN
Gene name: NUDT3
Protein name: Diphosphoinositol polyphosphate phosphohydrolase 1
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- small molecule metabolic process GO:0044281
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6ZS82 | RGS9BP | 0.53367 | nervous system process GO:0050877 signal transduction GO:0007165 |
| 2 | Q9Y3A3 | MOB4 | 0.40915 | |
| 3 | Q6ZUA9 | MROH5 | 0.38826 | |
| 4 | Q9HD42 | CHMP1A | 0.38677 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 5 | Q8N187 | CARF | 0.37255 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q8N7Q3 | ZNF676 | 0.35578 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 7 | Q6ZR52 | ZNF493 | 0.35578 | |
| 8 | Q99963 | SH3GL3 | 0.35091 | anatomical structure development GO:0048856 cell differentiation GO:0030154 signal transduction GO:0007165 ... |
| 9 | Q06330 | RBPJ | 0.3499 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 10 | P25024 | CXCR1 | 0.34221 | homeostatic process GO:0042592 immune system process GO:0002376 signal transduction GO:0007165 ... |
20 40 60 80 100 AA: MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIV STMI: DO_DISOPRED3: DDDDDD.............................................................................................. DO_IUPRED2A: D...DD........................................DDDDDDD.....DDDD...................................... DO_SPOTD: DDDDDDDD............................................................................................ CONSENSUS: DDDDDD.............................................................................................. CONSENSUS_MOBI: DDDDDDD.............................................................................................
120 140 160 AA: TEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR STMI: DO_DISOPRED3: .................................................DDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ........................................................................ DO_SPOTD: ..............................................DDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .................................................DDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[SV]: VVattySVSaqSSmS RICH_[TV]: TpVVaTTysV RICH_[NT]: NNgTpvvaTT RICH_MOBI_[Y]: YsanngtpvvattY RICH_MOBI_[SV]: VVattySVSaqSSmS RICH_MOBI_[TV]: TpVVaTTysV RICH_MOBI_[NT]: NNgTpvvaTT