Q6ZSB3 CB046_HUMAN
Gene name: LINC00299
Protein name: Putative uncharacterized protein encoded by LINC00299
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | E5RJ46 | C8orf87 | 0.85215 | |
| 2 | Q9BT76 | UPK3B | 0.85202 | |
| 3 | Q96RQ9 | IL4I1 | 0.76536 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 4 | Q8TF45 | ZNF418 | 0.73994 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | Q9UKW6 | ELF5 | 0.73994 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 6 | Q96D15 | RCN3 | 0.68508 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 7 | Q9NUM3 | SLC39A9 | 0.67165 | transport GO:0006810 |
| 8 | Q9UBC0 | ONECUT1 | 0.66353 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 9 | P35410 | MAS1L | 0.65841 | signal transduction GO:0007165 |
| 10 | Q6UXD1 | HRCT1 | 0.65602 |
20 40 60 80 100 AA: MVQREKARDNFEGGCLAELIGSPRDWKCFLAVPDPLLGVQHWLHLWRPQTKDGNSLHRHGDQAWGKHRRQNSLKSPALSGHSIDYHFYPRLRCGMLIGPD STMI: DO_DISOPRED3: DDDDDD.............................................................................................. DO_IUPRED2A: .DDD................................................D..DDDDDDDDDDDDDDDDD............................ DO_SPOTD: DDDDDDDDDD........................................DDDDDDDDDDDDDDDDDDDDDDDDD......................... CONSENSUS: DDDDDD..............................................DDDDDDDDDDDDDDDDDDDD............................ CONSENSUS_MOBI: .....................................................DDDDDDDDDDDDDDDDDDDDDD......................... RICH_[H]: HrHgdqawgkH RICH_MOBI_[H]: HrHgdqawgkH
120 AA: KQAVASGLEVLVTSSTKILGQLFPDAAHFLEEASEFKAE STMI: DO_DISOPRED3: .....................................DD DO_IUPRED2A: ....................................... DO_SPOTD: ..................................DDDDD CONSENSUS: .....................................DD CONSENSUS_MOBI: .......................................