E5RJ46 CH087_HUMAN

Gene name: C8orf87
Protein name: Uncharacterized protein C8orf87

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6ZSB3 LINC00299 0.85215
2 Q5VTB9 RNF220 0.72559 cell-cell signaling GO:0007267
cellular protein modification process GO:0006464
signal transduction GO:0007165
3 Q9BT76 UPK3B 0.72522
4 O95800 GPR75 0.72515 cell death GO:0008219
signal transduction GO:0007165
5 P59091 LINC00315 0.69604
6 Q8IVC4 ZNF584 0.68964 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
7 P10242 MYB 0.6805 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
8 Q96RQ9 IL4I1 0.65746 catabolic process GO:0009056
small molecule metabolic process GO:0044281
9 Q6UXD1 HRCT1 0.64645
10 Q96D15 RCN3 0.63656 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...

                                           20                  40                  60                  80                 100
AA:                      MRTPKRTRSPKTKVSLRGETLTLQLTTVSLDTRHMVKRCDERHGRPLPHSQESQHGSATSKKAVRGTADTAPLERISAARGWALPMEATVSVFRAHQWQW
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDD..................................DDDDDDDDDDDDDDD......................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDD.......DD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDD.....................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDD.........DDDDDD..D..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDD...................
CONSENSUS:               DDDDDDDDDDDDDDDDDDD............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................
CONSENSUS_MOBI:          ......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................
RICH_[H]:                                                          HgrplpHsqesqH                                             
RICH_[R]:                                                RhmvkRcdeRhgR                                                       
RICH_MOBI_[H]:                                                     HgrplpHsqesqH                                             

                                            
AA:                      N
STMI:                     
DO_DISOPRED3:            .
DO_IUPRED2A:             .
DO_SPOTD:                D
CONSENSUS:               .
CONSENSUS_MOBI:          .