Q6ZTR6 ZNFDT_HUMAN
Gene name: ZNF516-DT
Protein name: Putative uncharacterized protein ZNF516-DT
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y3D2 | MSRB2 | 0.91098 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 ... |
| 2 | Q9UK05 | GDF2 | 0.90677 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 3 | Q8WW36 | ZCCHC13 | 0.90216 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 4 | Q9Y263 | PLAA | 0.90216 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 5 | Q8NHA8 | OR1F12 | 0.84204 | signal transduction GO:0007165 |
| 6 | P54652 | HSPA2 | 0.80676 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 7 | P04632 | CAPNS1 | 0.79595 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 8 | Q14576 | ELAVL3 | 0.78449 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 9 | Q5UCC4 | EMC10 | 0.77463 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell population proliferation GO:0008283 ... |
| 10 | Q9Y295 | DRG1 | 0.77324 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
20 40 60 80 100 AA: MRVPPAGTWALRPIWTEMGTPLRGSQAPGRIVLLLLVITPQWRWIPSKTPNVAPRSNQRCNPGGYLSGGVSLCASHSQPAALPNLGRLQKKLLQTRCKGR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDD.................................................................................. DO_IUPRED2A: ...................D..........................DDDDDDDDDDDDD.........................DD.............. DO_SPOTD: DDDDDDDD........................................DDDDDDDDDD.......................................... CONSENSUS: DDDDDDDD........................................DDDDDDDDDD.......................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 AA: RMCPKAGDQTGGAFCMCDVSGGGGECVSGSGGGGESGRKTGTTSAMKDPRVLKCKLRVTNDLH STMI: DO_DISOPRED3: .............................DDDDDDDDDDDDDDDD.................. DO_IUPRED2A: ...........................DDDDDDDDDDDDDDDDDD.D................ DO_SPOTD: ......................DDDDDDDDDDDDDDDDDDDDDDDDD............DDDD CONSENSUS: ...........................DDDDDDDDDDDDDDDDDDDD................ CONSENSUS_MOBI: ............................................................... RICH_[G]: GsGGGGesGrktG RICH_[GT]: GesGrkTGTT RICH_fLPS_[G]: sGsGGGGesGrktGttsamk