Q9Y3D2 MSRB2_HUMAN
Gene name: MSRB2
Protein name: Methionine-R-sulfoxide reductase B2, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UK05 | GDF2 | 0.99964 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 2 | Q07627 | KRTAP1-1 | 0.99862 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 3 | Q9Y263 | PLAA | 0.99862 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 4 | Q9NZ38 | IDI2-AS1 | 0.99862 | |
| 5 | A5D6W6 | FITM1 | 0.99862 | biosynthetic process GO:0009058 |
| 6 | Q8NHA8 | OR1F12 | 0.96544 | signal transduction GO:0007165 |
| 7 | Q6ZTR6 | ZNF516-DT | 0.91098 | |
| 8 | P54652 | HSPA2 | 0.88166 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 9 | P04632 | CAPNS1 | 0.88105 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 10 | Q14576 | ELAVL3 | 0.86222 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
20 40 60 80 100 AA: MARLLWLLRGLTLGTAPRRAVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSS STMI: TTTTTTTTTTTTTTTTTTTT DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................... DO_IUPRED2A: ..................DDDDDDDDDDDDDDDDDDDD........................DDDDD........DD....................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD.......................................................... CONSENSUS_MOBI: ................................................................................ RICH_[G]: GqaGGGGpGtGpGlGeaG RICH_fLPS_[G]: vrGqaGGGGpGtGpGlGeaG
120 140 160 180 AA: EKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH STMI: DO_DISOPRED3: ................................................................................DD DO_IUPRED2A: ..............DDDDDDDDDDDDDDDDDDD.......................D......................... DO_SPOTD: ...............................................................................DDD CONSENSUS: ................................................................................DD CONSENSUS_MOBI: ..................................................................................