Q7LBR1 CHM1B_HUMAN

Gene name: CHMP1B
Protein name: Charged multivesicular body protein 1b

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- cell cycle GO:0007049
- cell division GO:0051301
- cellular component assembly GO:0022607
- chromosome organization GO:0051276
- chromosome segregation GO:0007059
- cytoskeleton organization GO:0007010
- membrane organization GO:0061024
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- protein transport GO:0015031
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P39086 GRIK1 0.76788 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
signal transduction GO:0007165
2 Q9Y2H1 STK38L 0.75636 cellular protein modification process GO:0006464
signal transduction GO:0007165
3 Q9H3Z4 DNAJC5 0.74037 cell death GO:0008219
cell-cell signaling GO:0007267
immune system process GO:0002376
...
4 Q96IY1 NSL1 0.70995 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...
5 Q7Z5S9 TMEM144 0.69166
6 Q5T9L3 WLS 0.68922 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell-cell signaling GO:0007267
...
7 P47992 XCL1 0.68869 biosynthetic process GO:0009058
cell adhesion GO:0007155
cell population proliferation GO:0008283
...
8 Q9BY67 CADM1 0.67713 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
cell adhesion GO:0007155
...
9 O43586 PSTPIP1 0.66352 cell adhesion GO:0007155
immune system process GO:0002376
response to stress GO:0006950
...
10 P43121 MCAM 0.65875 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...

                                           20                  40                  60                  80                 100
AA:                      MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMD
STMI:                                                                                                                        
DO_DISOPRED3:            DD..................................................................................................
DO_IUPRED2A:             .....................DDDDDDDDDDDDDDDDDD..........DDDDD..............................................
DO_SPOTD:                DDDDD...............................................................................................
CONSENSUS:               DD..................................................................................................
CONSENSUS_MOBI:          DDD.................................................................................................

                                          120                 140                 160                 180 
AA:                      ATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV
STMI:                                                                                                                       
DO_DISOPRED3:            ............................DDDDDDDDDDDDDDDDD........................DDDDDDDDDDDDDD................
DO_IUPRED2A:             ........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....
DO_SPOTD:                .......................DDDDDDDDDDDDDDDDDDDDDD...............DDDDDDDDDDDDDDDDDDDDDDDD...........DDDD
CONSENSUS:               ........................DDDDDDDDDDDDDDDDDDDDD................DDDDDDDDDDDDDDDDDDDDDDD...............
CONSENSUS_MOBI:          ................................................................DDDDDDDD...........................
RICH_[QT]:                                          QTQQmedTmssTTT                                                          
RICH_[T]:                                            TqqmedTmssTTTlTT                                                       
RICH_[MT]:                                           TqqMedTMssTTTlTT                                                       
RICH_fLPS_[T]:                                   ldvqTqqmedTmssTTTlTT