Q7RTV5 PXL2C_HUMAN
Gene name: PRXL2C
Protein name: Peroxiredoxin-like 2C
List of terms from Generic GO subset, which this protein is a part of:
- carbohydrate metabolic process GO:0005975
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- generation of precursor metabolites and energy GO:0006091
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NQX7 | ITM2C | 0.99376 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 2 | P16260 | SLC25A16 | 0.97398 | transport GO:0006810 |
| 3 | Q8NBI6 | XXYLT1 | 0.94106 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 4 | Q5VZF2 | MBNL2 | 0.92996 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 5 | Q8N2G6 | ZCCHC24 | 0.92789 | |
| 6 | P22695 | UQCRC2 | 0.9262 | generation of precursor metabolites and energy GO:0006091 protein maturation GO:0051604 protein targeting GO:0006605 ... |
| 7 | Q8WZ71 | TMEM158 | 0.89063 | |
| 8 | Q8IXU6 | SLC35F2 | 0.88453 | |
| 9 | Q53RT3 | ASPRV1 | 0.85196 | anatomical structure development GO:0048856 protein maturation GO:0051604 |
| 10 | Q99999 | GAL3ST1 | 0.83061 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVVVFVRHFLCYICKEYVEDLAKIPRSFLQEANVTLIVIGQSS STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[AP]: AAPAPvtrqvsgAAAlvPAPsgP RICH_[A]: AApApvtrqvsgAAAlvpA RICH_fLPS_[A]: mAApApvtrqvsgAAAlvpA
120 140 160 180 200 AA: YHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHRDRNRLDH STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .............................................................................................D...... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: KPINSVLQLVGVQHVNFTNRPSVIHV STMI: DO_DISOPRED3: .........................D DO_IUPRED2A: .......................... DO_SPOTD: .......................... CONSENSUS: .......................... CONSENSUS_MOBI: ..........................