Q8N2G6 ZCH24_HUMAN
Gene name: ZCCHC24
Protein name: Zinc finger CCHC domain-containing protein 24
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q7RTV5 | PRXL2C | 0.92789 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 2 | Q9NQX7 | ITM2C | 0.91769 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 3 | P16260 | SLC25A16 | 0.9032 | transport GO:0006810 |
| 4 | Q8NBI6 | XXYLT1 | 0.87402 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 5 | Q5VZF2 | MBNL2 | 0.86305 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 6 | P22695 | UQCRC2 | 0.85706 | generation of precursor metabolites and energy GO:0006091 protein maturation GO:0051604 protein targeting GO:0006605 ... |
| 7 | Q8WZ71 | TMEM158 | 0.83474 | |
| 8 | Q8IXU6 | SLC35F2 | 0.81749 | |
| 9 | Q53RT3 | ASPRV1 | 0.79132 | anatomical structure development GO:0048856 protein maturation GO:0051604 |
| 10 | Q99999 | GAL3ST1 | 0.79118 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MSLLSAIDTSAASVYQPAQLLNWVYLSLQDTHQASAFDAFRPEPTAGAAPPELAFGKGRPEQLGSPLHSSYLNSFFQLQRGEALSNSVYKGASPYGSLNN STMI: DO_DISOPRED3: DDDDDDDDDDDDDDD...DD....DDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................... DO_IUPRED2A: ....................................D.DDDD.....DDDDDDDDDDDDD........................................ DO_SPOTD: DDDDDDDDDDDDD...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............ CONSENSUS: DDDDDDDDDDDDD.................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................... CONSENSUS_MOBI: .................................................................................................... RICH_[AF]: AsAFdAFrpeptAgAA RICH_[AP]: AsAfdAfrPePtAgAAPPelAfgkgrP RICH_[A]: AsAfdAfrpeptAgAAppelA RICH_fLPS_[A]: AsAfdAfrpeptAgAAppelA
120 140 160 180 200 AA: IADGLSSLTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWMSGNSWANMGQECIKCHINVY STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ................DDDDDDD...............................D............................................. DO_SPOTD: ................DDDDDDDD..........................D................................................. CONSENSUS: ................DDDDDDD............................................................................. CONSENSUS_MOBI: ....................................................................................................
220 240 AA: PHKQRPLEKPDGLDVSDQSKEHPQHLCEKCKVLGYYCRRVQ STMI: DO_DISOPRED3: ......................................... DO_IUPRED2A: ......DDDDDDDDDD......................... DO_SPOTD: .......................................DD CONSENSUS: ......................................... CONSENSUS_MOBI: .........................................