Q86SG4 DPCA2_HUMAN

Gene name: HMGN2P46
Protein name: Putative Dresden prostate carcinoma protein 2

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6UX27 VSTM1 0.77102 immune system process GO:0002376
2 O15427 SLC16A3 0.76232 immune system process GO:0002376
small molecule metabolic process GO:0044281
transmembrane transport GO:0055085
...
3 O14986 PIP5K1B 0.73232 biosynthetic process GO:0009058
signal transduction GO:0007165
4 P09681 GIP 0.72792 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell-cell signaling GO:0007267
...
5 P35452 HOXD12 0.7239 anatomical structure development GO:0048856
embryo development GO:0009790
6 P61925 PKIA 0.71829 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
7 Q9Y446 PKP3 0.7138 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
8 Q7LC44 ARC 0.69201 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
9 O14745 SLC9A3R1 0.65712 anatomical structure development GO:0048856
cell cycle GO:0007049
cell death GO:0008219
...
10 P35250 RFC2 0.6401 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MEPWAMRALDFADESGSVSCKDMHLLLWLQKRIEMHKAEQCEEEEAMTPRPTKARAPLPSAYVPPLSLPPCPRERLKGMLKEIKPRLSRNCREDPQGCLL
STMI:                                                                                                                        
DO_DISOPRED3:            DD.D......................................DDD.D...DD.D...DDDDDDDDDDDDDDDDD.....DDDDDDDDD.....DDDDDDD
DO_IUPRED2A:             ......................................DDDDDDDDDDDDDDDDDDDDDDDDD.D.....................D.............
DO_SPOTD:                DDDDDDDDDDDDDDDDD.D.DDDDD.......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDD..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDDDDDDD.....DDDDDDD
CONSENSUS_MOBI:          .......................................DDDDDDDDDDDDDDDDDDDDDD.......................................
RICH_[AE]:                                                        EEEEAmtprptkArAplpsA                                       
RICH_[AP]:                                                            AmtPrPtkArAPlPsAyvPP                                   
RICH_[L]:                                                                                                                  LL
RICH_[P]:                                                                PrPtkaraPlPsayvPPlslPPcP                            
RICH_[EP]:                                                        EEEEamtPrPtkaraPlP                                         
RICH_[LR]:                                                                                                                 LL
RICH_fLPS_[P]:                                                                   PlPsayvPPlslPPcP                            
RICH_fLPS_[E]:                                                 EqcEEEEamt                                                    
RICH_MOBI_[AE]:                                                   EEEEAmtprptkArAplpsA                                       

                                          120                 140                 160        
AA:                      NLLLQSHSRSPERPLQRRERRYLQRRREKLMLARRGITLQKMEMPKQTRHRKLKVLEMPSEVCAFLITVYFW
STMI:                                                                                            
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......D........................
DO_IUPRED2A:             .........DD..DDDDDDDD.............DDDDDDDDDDDDDDDDDD....................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................
CONSENSUS_MOBI:          ........................................................................
RICH_[L]:                nLLLqshsrsperpL                                                         
RICH_[M]:                                              MlarrgitlqkMeM                            
RICH_[R]:                        RspeRplqRReRRylqRRReklmlaRR                                     
RICH_[LR]:               nLLLqshsRspeRpLqRReRR LqRRRekLmL                                        
RICH_fLPS_[R]:                   RspeRplqRReRRylqRRReklmlaRR