Q70IA8 MOB3C_HUMAN
Gene name: MOB3C
Protein name: MOB kinase activator 3C
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q86TA1 | MOB3B | 0.89451 | signal transduction GO:0007165 |
| 2 | P43155 | CRAT | 0.79859 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 protein targeting GO:0006605 ... |
| 3 | Q96BX8 | MOB3A | 0.73578 | |
| 4 | Q8IZU8 | DSEL | 0.7295 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 5 | Q8WV37 | ZNF480 | 0.71396 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q6UXG2 | ELAPOR1 | 0.71396 | catabolic process GO:0009056 cellular component assembly GO:0022607 response to stress GO:0006950 |
| 7 | Q9NV72 | ZNF701 | 0.67149 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | O43615 | TIMM44 | 0.66993 | protein targeting GO:0006605 protein transport GO:0015031 transmembrane transport GO:0055085 ... |
| 9 | P09543 | CNP | 0.61587 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 10 | Q9HBE4 | IL21 | 0.60872 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MALCLKQVFAKDKTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNRINLIYGTMAERCSETSCPVMAGGPRYEYRW STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[F]: FakdktFrprkrF RICH_[K]: KqvfaKdKtfrprK RICH_[FK]: KqvFaKdKtF RICH_[KR]: KdKtfRpRKR
120 140 160 180 200 AA: QDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYFIREFSLVD STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: QRELEPLREMTERICH STMI: DO_DISOPRED3: ................ DO_IUPRED2A: ................ DO_SPOTD: ................ CONSENSUS: ................ CONSENSUS_MOBI: ................