Q86TG1 T150A_HUMAN
Gene name: TMEM150A
Protein name: Transmembrane protein 150A
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A6BM72 | MEGF11 | 0.99102 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 |
| 2 | Q9NY30 | BTG4 | 0.92952 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 3 | P51685 | CCR8 | 0.90306 | cell adhesion GO:0007155 homeostatic process GO:0042592 immune system process GO:0002376 ... |
| 4 | Q9NTU7 | CBLN4 | 0.86928 | anatomical structure development GO:0048856 cell junction organization GO:0034330 cellular component assembly GO:0022607 ... |
| 5 | Q8IYF3 | TEX11 | 0.85823 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell death GO:0008219 ... |
| 6 | Q8WY64 | MYLIP | 0.80329 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 7 | P51582 | P2RY4 | 0.78034 | cell-cell signaling GO:0007267 homeostatic process GO:0042592 signal transduction GO:0007165 ... |
| 8 | Q5MJ68 | SPDYC | 0.76791 | cell cycle GO:0007049 |
| 9 | P60410 | KRTAP10-8 | 0.75895 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 10 | A6NFQ7 | DPRX | 0.7587 |
20 40 60 80 100 AA: MTAWILLPVSLSAFSITGIWTVYAMAVMNHHVCPVENWSYNESCPPDPAEQGGPKTCCTLDDVPLISKCGSYPPESCLFSLIGNMGAFMVALICLLRYGQ STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDD..D..............................DDDDDDDD............................................. DO_IUPRED2A: .............................................D...................................................... DO_SPOTD: .DDDDDDDDDDDD....................................................................................... CONSENSUS: .D .................................................... .... CONSENSUS_MOBI: .. .................................................... ....
120 140 160 180 200 AA: LLEQSRHSWVNTTALITGCTNAAGLLVVGNFQVDHARSLHYVGAGVAFPAGLLFVCLHCALSYQGATAPLDLAVAYLRSVLAVIAFITLVLSGVFFVHES STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ........ ........... ................. . CONSENSUS_MOBI: ........ ........... ................. .
220 240 260 AA: SQLQHGAALCEWVCVIDILIFYGTFSYEFGAVSSDTLVAALQPTPGRACKSSGSSSTSTHLNCAPESIAMI STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ....................................................................... DO_SPOTD: .........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ........... ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ........... ....................................... RICH_[S]: SSgSSStSthlncapeS RICH_[CS]: CkSSgSSStSthlnCapeS RICH_fLPS_[S]: ckSSgSSStS