Q9NTU7 CBLN4_HUMAN

Gene name: CBLN4
Protein name: Cerebellin-4

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell junction organization GO:0034330
- cellular component assembly GO:0022607
- protein transport GO:0015031
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NY30 BTG4 0.9338 anatomical structure development GO:0048856
cell cycle GO:0007049
cell differentiation GO:0030154
...
2 Q86TG1 TMEM150A 0.86928 catabolic process GO:0009056
3 Q8IYF3 TEX11 0.86219 anatomical structure development GO:0048856
cell cycle GO:0007049
cell death GO:0008219
...
4 A6BM72 MEGF11 0.8203 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
5 P51582 P2RY4 0.79126 cell-cell signaling GO:0007267
homeostatic process GO:0042592
signal transduction GO:0007165
...
6 Q5MJ68 SPDYC 0.77812 cell cycle GO:0007049
7 P60410 KRTAP10-8 0.76244 anatomical structure development GO:0048856
cell differentiation GO:0030154
8 A6NFQ7 DPRX 0.7601
9 Q9NSB2 KRT84 0.69662 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
10 Q96SZ6 CDK5RAP1 0.68971 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...

                                           20                  40                  60                  80                 100
AA:                      MGSGRRALSAVPAVLLVLTLPGLPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILV
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSS                                                                         
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................
DO_IUPRED2A:             ......................................................D.............................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................
CONSENSUS:                                          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................
CONSENSUS_MOBI:                                     .........................................................................
RICH_[S]:                                                             SnpatdSkgSSSSplgiS                                     
RICH_[CS]:                                                      ClvvCdSnpatdSkgSSSS                                          
RICH_[CV]:                                                 VlegkClVVC                                                        

                                          120                 140                 160                 180                 200
AA:                      NVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLVGGWQYSTFSGFLVFP
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                            
AA:                      L
STMI:                     
DO_DISOPRED3:            .
DO_IUPRED2A:             .
DO_SPOTD:                .
CONSENSUS:               .
CONSENSUS_MOBI:          .