Q86WC6 PPR27_HUMAN
Gene name: PPP1R27
Protein name: Protein phosphatase 1 regulatory subunit 27
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O60762 | DPM1 | 0.84811 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 2 | P33681 | CD80 | 0.84774 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 3 | Q9NUL7 | DDX28 | 0.84293 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 ribonucleoprotein complex assembly GO:0022618 ... |
| 4 | Q9Y3A4 | RRP7A | 0.82373 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cellular component assembly GO:0022607 ... |
| 5 | P50749 | RASSF2 | 0.78456 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell death GO:0008219 ... |
| 6 | O60359 | CACNG3 | 0.78335 | circulatory system process GO:0003013 nervous system process GO:0050877 protein targeting GO:0006605 ... |
| 7 | Q15036 | SNX17 | 0.78322 | anatomical structure development GO:0048856 catabolic process GO:0009056 protein transport GO:0015031 ... |
| 8 | Q9H7R5 | ZNF665 | 0.77838 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | B1APH4 | ZNF487 | 0.75368 | |
| 10 | Q9HCL3 | ZFP14 | 0.74927 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MPSRTARYARYSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVKYGADIHQRDEAGWTP STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: ....DDDDDD.......................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[RY]: RtaRYaRYspRqRRRR RICH_[R]: RtaRyaRyspRqRRRR RICH_fLPS_[R]: mpsRtaRyaRyspRqRRRRm
120 140 AA: LHIACSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD STMI: DO_DISOPRED3: ....................................................DD DO_IUPRED2A: ............................DDDDD..................... DO_SPOTD: .................................................DDDDD CONSENSUS: ....................................................DD CONSENSUS_MOBI: ......................................................