Q86WH2 RASF3_HUMAN
Gene name: RASSF3
Protein name: Ras association domain-containing protein 3
List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P41587 | VIPR2 | 0.73106 | cell population proliferation GO:0008283 cell-cell signaling GO:0007267 signal transduction GO:0007165 |
| 2 | P05120 | SERPINB2 | 0.73106 | cell death GO:0008219 response to stress GO:0006950 signal transduction GO:0007165 |
| 3 | Q9HBV1 | POPDC3 | 0.68232 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 4 | Q9UBV4 | WNT16 | 0.68232 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 5 | Q96L58 | B3GALT6 | 0.64078 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 6 | Q5T9C9 | PIP5KL1 | 0.62511 | cell death GO:0008219 cellular protein modification process GO:0006464 |
| 7 | Q8N6K7 | SAMD3 | 0.61604 | |
| 8 | Q9GZY8 | MFF | 0.59029 | anatomical structure development GO:0048856 cell death GO:0008219 protein targeting GO:0006605 ... |
| 9 | Q13393 | PLD1 | 0.58811 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 10 | Q96LR9 | APOLD1 | 0.5786 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MSSGYSSLEEDAEDFFFTARTSFFRRAPQGKPRSGQQDVEKEKETHSYLSKEEIKEKVHKYNLAVTDKLKMTLNSNGIYTGFIKVQMELCKPPQTSPNSG STMI: DO_DISOPRED3: DDDDDDDDDDDDDDD....DDD.DD.....DDDDDDDDDDDDDDDDD.................................................DD.D DO_IUPRED2A: DDDD......................DDDDDDDDDDDDDDDDDDDDDDDD...........................................DDDDDDD DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................... CONSENSUS: DDDDDDDDDDDDDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................DDDD CONSENSUS_MOBI: .........................DDDDDDDDDDDDDDDDDDDDDDD.................................................... RICH_[R]: RtsffRRapqgkpR RICH_[FQ]: FFrrapQgkprsgQQ
120 140 160 180 200 AA: KLSPSSNGCMNTLHISSTNTVGEVIEALLKKFLVTESPAKFALYKRCHREDQVYACKLSDREHPLYLRLVAGPRTDTLSFVLREHEIGEWEAFSLPELQN STMI: DO_DISOPRED3: .DDD................................................................................................ DO_IUPRED2A: DDDDDDD.....D....................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: DDDD................................................................................................ CONSENSUS_MOBI: ....................................................................................................
220 AA: FLRILDKEEDEQLQNLKRRYTAYRQKLEEALREVWKPD STMI: DO_DISOPRED3: ....................................DD DO_IUPRED2A: ...................................... DO_SPOTD: ..................................DDDD CONSENSUS: ....................................DD CONSENSUS_MOBI: ......................................