Q96LR9 APLD1_HUMAN
Gene name: APOLD1
Protein name: Apolipoprotein L domain-containing protein 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell differentiation GO:0030154
- response to stress GO:0006950
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P0CG22 | DHRS4L1 | 0.9482 | |
| 2 | Q9BQ24 | ZFYVE21 | 0.848 | |
| 3 | Q9UBV4 | WNT16 | 0.848 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 4 | Q9HBV1 | POPDC3 | 0.848 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 5 | Q9H845 | ACAD9 | 0.83232 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 small molecule metabolic process GO:0044281 |
| 6 | A6NJ08 | MBD3L5 | 0.81353 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | P20338 | RAB4A | 0.81192 | biosynthetic process GO:0009058 immune system process GO:0002376 protein transport GO:0015031 ... |
| 8 | Q9GZS9 | CHST5 | 0.8074 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular protein modification process GO:0006464 ... |
| 9 | A6NE82 | MBD3L3 | 0.80703 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q96L58 | B3GALT6 | 0.79637 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
20 40 60 80 100 AA: MFRAPCHRLRARGTRKARAGAWRGCTFPCLGKGMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALA STMI: MMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDD................................................................................. DO_IUPRED2A: ..................................DDDDDDDDDD........................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................D.DDD.DDDDDD.DDD CONSENSUS: DDDDDDDDDDDDDDDDDDD...............DDDDDDDDDD...................................... CONSENSUS_MOBI: .................................................................................. RICH_[AR]: RARgtRkARA RICH_[R]: RapchRlRaRgtRkaR
120 140 160 180 200 AA: AIVGLSLSPVTLGTSLLVSAVGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYF STMI: MMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DD..D............................................................................................... CONSENSUS: ................ ................................................. CONSENSUS_MOBI: ................ .................................................
220 240 260 AA: IVFFGSRGFLIPRRAEGDTKVSQAVLKAKIQKLAESLESCTGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF STMI: MMMMMMMMMMMM DO_DISOPRED3: ..............................................................DDDDDDDDDDDDDDDDD DO_IUPRED2A: ............................................................................... DO_SPOTD: ..........................................................DDDDDDDDDDDDDDDDDDDDD CONSENSUS: ..................................................DDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ...................................................................