Q8IVM7 CM029_HUMAN
Protein name: Deleted.
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O75420 | GIGYF1 | 0.74147 | signal transduction GO:0007165 |
| 2 | O75908 | SOAT2 | 0.73676 | cell differentiation GO:0030154 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
| 3 | Q14147 | DHX34 | 0.73106 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 nucleobase-containing compound catabolic process GO:0034655 |
| 4 | Q2M2E3 | ODF4 | 0.73074 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 5 | Q00975 | CACNA1B | 0.72469 | cell-cell signaling GO:0007267 circulatory system process GO:0003013 response to stress GO:0006950 ... |
| 6 | Q86TN4 | TRPT1 | 0.71345 | cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
| 7 | O60312 | ATP10A | 0.71232 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 membrane organization GO:0061024 ... |
| 8 | Q86V71 | ZNF429 | 0.71098 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | Q5TZK3 | FAM74A4 | 0.70823 | |
| 10 | Q2TAM9 | TUSC1 | 0.70752 |
20 40 60 80 100 AA: MRPQPRGGSGRKENTGEEREGRAERYHAISADGERRLQPGTAVLTRHVSFLFGGREAEEHVMETDRVEGARDGDKRKEVCFVPIQGSFCFMRLTCARLVA STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD............................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...DDDD....................DDDDDDDDDD..D........................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDD.......................DD..DDDDDDDDDDDD......................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................DDDDDDDDDDDDD........................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... RICH_[E]: EntgEErEgraE RICH_[G]: GGsGrkentGeereG RICH_[R]: RpqpRggsgRkentgeeRegRaeR RICH_[EG]: GGsGrkEntGEErEGraE RICH_[ER]: RpqpRggsgRkEntgEEREgRaER RICH_[GR]: RpqpRGGsGRkentGeeReGRaeR RICH_MOBI_[E]: EntgEErEgraE RICH_MOBI_[G]: GGsGrkentGeereG RICH_MOBI_[R]: RpqpRggsgRkentgeeRegRaeR RICH_MOBI_[EG]: GGsGrkEntGEErEGraE RICH_MOBI_[ER]: RpqpRggsgRkEntgEEREgRaER RICH_MOBI_[GR]: RpqpRGGsGRkentGeeReGRaeR
120 140 160 AA: ALDIHGLSFSLRFCGSRDTKHEDITGREGQVTPLPRGTPQLCTARVGLSSPRTRGQGVPISCKT STMI: DO_DISOPRED3: ......................................................DDDDDD...D DO_IUPRED2A: .....................DDDDDDDDDDDDDDDD....DD.DDD...........DDD... DO_SPOTD: ................DDDDDDDDDDDDDDDDD.............DDDDDDDDDDD....... CONSENSUS: .....................DDDDDDDDDDDD.............D.......DDDDDD.... CONSENSUS_MOBI: ................................................................