Q8IVN3 MSTN1_HUMAN

Gene name: MUSTN1
Protein name: Musculoskeletal embryonic nuclear protein 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- growth GO:0040007

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P47897 QARS1 0.78913 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
2 Q96T60 PNKP 0.78785 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
3 P46013 MKI67 0.77499 cell cycle GO:0007049
cell population proliferation GO:0008283
chromosome organization GO:0051276
...
4 B7Z8K6 TRDC 0.71136 immune system process GO:0002376
membrane organization GO:0061024
response to stress GO:0006950
...
5 Q14DG7 TMEM132B 0.7064
6 Q96RR1 TWNK 0.70388 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
7 Q9H0C3 TMEM117 0.70016 cell death GO:0008219
response to stress GO:0006950
signal transduction GO:0007165
8 Q8N7X0 ADGB 0.69842
9 Q4KWH8 PLCH1 0.6961 biosynthetic process GO:0009058
catabolic process GO:0009056
homeostatic process GO:0042592
...
10 Q16666 IFI16 0.69444 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                  
AA:                      MSQAGAQEAPIKKKRPPVKDEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFEKPKAGPTKSVFG
STMI:                                                                                                      
DO_DISOPRED3:            DDDDDDDDD...................................................................DDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[K]:                           KKKrppvKdedlKgargnltK                                                  
RICH_[T]:                                                                            TrTgTeTvfekpkagpT     
RICH_MOBI_[K]:                      KKKrppvKdedlKgargnltK                                                  
RICH_MOBI_[T]:                                                                       TrTgTeTvfekpkagpT     
RICH_MOBI_[FT]:                                                                   FsrTrTgTeTvFekpkagpT