Q8N0T1 RBIS_HUMAN
Gene name: RBIS
Protein name: Ribosomal biogenesis factor
List of terms from Generic GO subset, which this protein is a part of:
- ribosome biogenesis GO:0042254
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q92616 | GCN1 | 0.86556 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 response to stress GO:0006950 |
| 2 | Q13576 | IQGAP2 | 0.80964 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 immune system process GO:0002376 ... |
| 3 | Q9Y6A9 | SPCS1 | 0.79708 | biological process involved in symbiotic interaction GO:0044403 cellular nitrogen compound metabolic process GO:0034641 protein maturation GO:0051604 ... |
| 4 | Q9Y3N9 | OR2W1 | 0.79708 | |
| 5 | O60675 | MAFK | 0.79708 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q9UGM1 | CHRNA9 | 0.75321 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 cellular protein modification process GO:0006464 ... |
| 7 | Q9NWL6 | ASNSD1 | 0.74593 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 8 | Q8TC29 | ENKUR | 0.73584 | |
| 9 | Q6P2S7 | TTC41P | 0.73136 | |
| 10 | Q5T601 | ADGRF1 | 0.72193 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
20 40 60 80 AA: MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKINIMNEEKVNRVNKAFVNVQKELAHFAKSISLEPLQKELIPQQRHESKPVNVDEATRLMALL STMI: DO_DISOPRED3: DDDDDDDDD........................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDD..DDDDD...DDDDDDD..DDDDDDDD.D...............................DDDDDDDDDDDDDDDDD......... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................DDDDDDDDDDDDDDDDD......... CONSENSUS_MOBI: .................................................................................................... RICH_[K]: KnKlrgpKsrnvfhiasqKnfKaKnKaK RICH_[FN]: NvFhiasqkNFkakN RICH_[KN]: KNfKaKNKaKpvttN