Q8N111 CEND_HUMAN

Gene name: CEND1
Protein name: Cell cycle exit and neuronal differentiation protein 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- developmental maturation GO:0021700

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P16402 H1-3 0.794 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
2 Q14008 CKAP5 0.77007 cell cycle GO:0007049
cell division GO:0051301
cellular component assembly GO:0022607
...
3 P10412 H1-4 0.75179 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
4 Q8IZA3 H1-8 0.75082 biosynthetic process GO:0009058
cell cycle GO:0007049
cell differentiation GO:0030154
...
5 Q96MC5 BMERB1 0.7435 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
6 O94811 TPPP 0.73644 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell cycle GO:0007049
...
7 P16403 H1-2 0.70977 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
8 Q9H1R3 MYLK2 0.70868 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
9 Q16778 H2BC21 0.70831 cellular component assembly GO:0022607
chromosome organization GO:0051276
immune system process GO:0002376
...
10 Q86V59 PNMA8A 0.70715

                                           20                  40                  60                  80                 100
AA:                      MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQPPAAPTTAPAKKTSAKADPALLNNHSNLKPAPTVPSSPDATPEPKGPGDG
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................DDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AE]:                                                                                                        AtpEpkgpgdg
RICH_[AG]:                                                                                                        AtpepkGpGdG
RICH_[AK]:                                      AKvppAAdgKApltKpsKKeApAeK         ApAKKtsAKAdpAllnnhsnlK                     
RICH_[AN]:                                                                               AkAdpAllNN                          
RICH_[AP]:                                PqvtteAkvPPAAdgkAP   PskkeAPAekqqPPAAPttAPAkktsAkAdPA                 PdAtPePkgPgdg
RICH_[AT]:                                                                    ApTTApAkkT                                     
RICH_[A]:                                                           ApAekqqppAApttApA                                        
RICH_[G]:                                                                                                               GpGdG
RICH_[K]:                     KsasspKpdtKvpqvtteaK       KapltKpsKKeapaeK            KKtsaKadpallnnhsnlK                     
RICH_[P]:                                                                                               PaPtvPssPdatPePkgP   
RICH_[V]:                                VpqVtteakV                                                                          
RICH_[EG]:                                                                                                           EpkGpGdG
RICH_[EP]:                                                                                                      PdatPEPkgPgdg
RICH_[GP]:                                                                                                          PePkGPGdG
RICH_[KP]:                                       KvPPaadgKaPltKPsKKeaP  KqqPPaaPttaPaKKtsaK                                  
RICH_fLPS_[A]:                                                             ppAApttApAkktsAkAdpA                              
RICH_fLPS_[G]:                                                                                                          GpGdG
RICH_MOBI_[AE]:                                                                                                   AtpEpkgpgdg
RICH_MOBI_[AG]:                                                                                                   AtpepkGpGdG
RICH_MOBI_[AK]:                                 AKvppAAdgKApltKpsKKeApAeK         ApAKKtsAKAdpAllnnhsnlK                     
RICH_MOBI_[AN]:                                                                          AkAdpAllNN                          
RICH_MOBI_[AP]:                                                            PPAAPttAPA                                        
RICH_MOBI_[AT]:                                                               ApTTApAkkT                                     
RICH_MOBI_[A]:                                                      ApAekqqppAApttApA                                        
RICH_MOBI_[G]:                                                                                                          GpGdG
RICH_MOBI_[K]:                KsasspKpdtKvpqvtteaK       KapltKpsKKeapaeK            KKtsaKadpallnnhsnlK                     
RICH_MOBI_[P]:                                                                                          PaPtvPssPdatPePkgP   
RICH_MOBI_[V]:                           VpqVtteakV                                                                          
RICH_MOBI_[EG]:                                                                                                      EpkGpGdG
RICH_fLPS_MOBI_[A]:                                                        ppAApttApAkktsAkAdpA                              
RICH_fLPS_MOBI_[G]:                                                                                                     GpGdG

                                          120                 140           
AA:                      AEEDEAASGGPGGRGPWSCENFNPLLVAGGVAVAAIALILGVAFLVRKK
STMI:                                             MMMMMMMMMMMMMMMMMMMMM   
DO_DISOPRED3:            DDDDDDDDDDDDD...................................D
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDD...........................
DO_SPOTD:                DDDDDDDDDDDDDDD.................................D
CONSENSUS:               DDDDDDDDDDDDDDD..........                     ..D
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDD........                     ...
RICH_[AE]:               AEEdEAA                                          
RICH_[AG]:               AeedeAAsG                                        
RICH_[AP]:               AeedeAA                                          
RICH_[G]:                aeedeaasGGpGGrG                                  
RICH_[EG]:               aEEdEaasGGpG                                     
RICH_[EP]:               aEEdE                                            
RICH_[GP]:               aeedeaasGGP                                      
RICH_fLPS_[G]:           aeedeaasGGpGGrG                                  
RICH_MOBI_[AE]:          AEEdEAA                                          
RICH_MOBI_[AG]:          AeedeAAsG                                        
RICH_MOBI_[G]:           aeedeaasGGpGGrG                                  
RICH_MOBI_[EG]:          aEEdEaasGGpG                                     
RICH_fLPS_MOBI_[G]:      aeedeaasGGpGGrG