Q96MC5 MERB1_HUMAN
Gene name: BMERB1
Protein name: bMERB domain-containing protein 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell differentiation GO:0030154
- cytoskeleton organization GO:0007010
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q16778 | H2BC21 | 0.76131 | cellular component assembly GO:0022607 chromosome organization GO:0051276 immune system process GO:0002376 ... |
| 2 | O60701 | UGDH | 0.75822 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 3 | P16402 | H1-3 | 0.74735 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | P62807 | H2BC4 | 0.74459 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 5 | Q8N111 | CEND1 | 0.7435 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 6 | Q93079 | H2BC9 | 0.74122 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 7 | P23527 | H2BC17 | 0.73997 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 8 | O60814 | H2BC12 | 0.73728 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 9 | Q5QNW6 | H2BC18 | 0.72228 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
| 10 | Q63ZY6 | NSUN5P2 | 0.7137 |
20 40 60 80 100 AA: MELKQSLSTHLEAEKPLRRYGAVEETAWKTERLGRNQLDIISMAETTMMPEEIELEMAKIQRLREVLVRRESELRFMMDDIQLCKDIMDLKQELQNLVAI STMI: DO_DISOPRED3: DDDDDD...............................DDD..DDDD...................................................... DO_IUPRED2A: .....D.....................................D.......D................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................... CONSENSUS: DDDDDD...............................DDDDDDDDD...................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: PEKEKTKLQKQREDELIQKIHKLVQKRDFLVDDAEVERLREQEEDKEMADFLRIKLKPLDKVTKSPASSRAEKKAEPPPSKPTVAKTGLALIKDCCGATQ STMI: DO_DISOPRED3: ............................................................DDDDDDDDDDDDDDDDDDDDDDD................. DO_IUPRED2A: DDDDDD..D.DD...........................DDDD...................DDDDDDDDDDDDDDDDDDDDDDDDD............. DO_SPOTD: ..............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D............... CONSENSUS: ............................................................DDDDDDDDDDDDDDDDDDDDDDDDD............... CONSENSUS_MOBI: .............................................................DDDDDDDDDDDDDDDDDDDDDDDDDD............. RICH_[AP]: PAssrAekkAePPPskPtvA RICH_[K]: KvtKspassraeKKaepppsK RICH_[KP]: KvtKsPassraeKKaePPPsKP RICH_MOBI_[AK]: AssrAeKKAepppsKptvAK RICH_MOBI_[K]: KspassraeKKaepppsK RICH_MOBI_[KP]: KKaePPPsKP
AA: CNIM STMI: DO_DISOPRED3: .... DO_IUPRED2A: .... DO_SPOTD: .DDD CONSENSUS: .... CONSENSUS_MOBI: ....