Q8N112 LSME2_HUMAN
Gene name: LSMEM2
Protein name: Leucine-rich single-pass membrane protein 2
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NPF2 | CHST11 | 0.70711 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 2 | Q6P179 | ERAP2 | 0.70711 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 circulatory system process GO:0003013 ... |
| 3 | P51793 | CLCN4 | 0.70353 | transmembrane transport GO:0055085 transport GO:0006810 |
| 4 | Q96PP9 | GBP4 | 0.68536 | immune system process GO:0002376 response to stress GO:0006950 |
| 5 | Q13336 | SLC14A1 | 0.6396 | transmembrane transport GO:0055085 transport GO:0006810 |
| 6 | P25800 | LMO1 | 0.6247 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 7 | Q9UNH6 | SNX7 | 0.58037 | protein transport GO:0015031 transport GO:0006810 |
| 8 | Q8NET4 | RTL9 | 0.50598 | |
| 9 | Q96ES7 | SGF29 | 0.50508 | cellular protein modification process GO:0006464 chromosome organization GO:0051276 |
| 10 | Q15262 | PTPRK | 0.49427 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MPSLAPDCPLLAMPEETQEDSVAPMMPSQRSRGPLAPNHVHEVCLHQVESISDLHSGAGTLRPYLTEEARPWDELLGVLPPSLCAQAGCSPVYRRGGFLL STMI: MMMM DO_DISOPRED3: DDDDDD.DDDDDDDD.DDDDDDDDDDDD..D.D................................................................... DO_IUPRED2A: ........DDDD..DDD.DDDDDDDDDDDDDDD................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................... CONSENSUS_MOBI: ................................................................................................ RICH_[M]: MpeetqedsvapMM
120 140 160 AA: LLALLVLTCLVLALLAVYLSVLQSESLRILAHTLRTQEETLLKLRLASLSQLRRLNSSEAQAPS STMI: MMMMMMMMMMMMMMMMM DO_DISOPRED3: .........................................................DDDDDDD DO_IUPRED2A: ..............................................................D. DO_SPOTD: ......................................................DDDDDDDDDD CONSENSUS: ........................................DDDDDDD CONSENSUS_MOBI: ...............................................