Q8N1V8 CJ085_HUMAN
Gene name: LINC01561
Protein name: Uncharacterized protein encoded by LINC01561
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O95900 | TRUB2 | 0.74421 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 2 | Q5JUK2 | SOHLH1 | 0.62981 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 3 | Q66K80 | RUSC1-AS1 | 0.59451 | |
| 4 | Q9GZP9 | DERL2 | 0.5547 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cell population proliferation GO:0008283 ... |
| 5 | Q9HBE5 | IL21R | 0.53971 | immune system process GO:0002376 signal transduction GO:0007165 |
| 6 | Q99611 | SEPHS2 | 0.53814 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 7 | Q01860 | POU5F1 | 0.52388 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 8 | Q8IUH3 | RBM45 | 0.51018 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 9 | Q6ZRV3 | LINC00696 | 0.4888 | |
| 10 | A2IDD5 | CCDC78 | 0.48863 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
20 40 60 80 100 AA: MAWRVPGVRPASTFFPQVLRASSELPNRLPEGSTVGPKPDSSWEAGSQGNWGLTSSGAGQDSSAQKLGILSVQISLKIWTWEKPSGWGHLHAAVTGASCC STMI: DO_DISOPRED3: DD.................................................................................................. DO_IUPRED2A: .........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................... DO_SPOTD: DD............................DDDDDD.D.D.....DD......DDDDDDDDDDD.................................... CONSENSUS: DD............................DDDDDDDDDD.....DD......DDDDD.......................................... CONSENSUS_MOBI: ........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................... RICH_MOBI_[G]: GsqGnwGltssGaG RICH_MOBI_[GW]: GstvGpkpdssWeaGsqGnWG
120 AA: SPLSQGGAICLVTAPQDKPDCSPCTSGH STMI: DO_DISOPRED3: ....................D.D..DDD DO_IUPRED2A: .....................DDDDD.. DO_SPOTD: ...............DDDDDDDDDDDDD CONSENSUS: ....................DDDDDDDD CONSENSUS_MOBI: ............................