Q6ZRV3 CC074_HUMAN
Gene name: LINC00696
Protein name: Putative uncharacterized protein encoded by LINC00696
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8N1Y9 | n/a | 0.98094 | |
| 2 | Q96BZ9 | TBC1D20 | 0.97522 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 3 | O15552 | FFAR2 | 0.95011 | cell differentiation GO:0030154 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
| 4 | P57738 | TCTA | 0.9469 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 5 | Q8IY22 | CMIP | 0.94267 | anatomical structure development GO:0048856 embryo development GO:0009790 |
| 6 | Q8IUH3 | RBM45 | 0.94121 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 7 | Q9GZP9 | DERL2 | 0.8812 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cell population proliferation GO:0008283 ... |
| 8 | Q5T319 | FAM182B | 0.861 | |
| 9 | A2IDD5 | CCDC78 | 0.85792 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 10 | Q99611 | SEPHS2 | 0.85489 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
20 40 60 80 100 AA: MQSVDSMLGTVGGCGGGEAASTFSKDPSGCCVGNDCRDGGRGLERRHGRWSRGEGGESGLCSGGQMASEIEYWDGLAISVMEVEKAFGSTNVLWKTEPFS STMI: DO_DISOPRED3: DDDDDDDDDDDDDD...................................................................................... DO_IUPRED2A: ...........................................DDDDDDD...DDD..D.D....................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................... CONSENSUS: DDDDDDDDDDDDDD.............................DDDDDDDDDDDDDDDDDD....................................... CONSENSUS_MOBI: .................................................................................................... RICH_[G]: GrwsrGeGGesG RICH_[GR]: RhGRwsRGeG
120 140 160 AA: LWACTAACPPSLSPTLLALGLPRDGKELAEQGSLWTVLEPGGDWSHSQSQLGTPGRGKGALGF STMI: DO_DISOPRED3: ...............................................DDDDDDDDDDDDDDDD DO_IUPRED2A: ...............................DD......D....DDDDDDDD........... DO_SPOTD: ..........................................DDDDDDDDDDDDDDDDDDDDD CONSENSUS: ............................................DDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .......................................DDDDDDDDDDDDDDDDDDDDDDDD RICH_[G]: GtpGrGkGalG RICH_MOBI_[G]: GGdwshsqsqlGtpGrGkGalG