Q8N5I3 KCNRG_HUMAN
Gene name: KCNRG
Protein name: Potassium channel regulatory protein
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein-containing complex assembly GO:0065003
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | O43915 | VEGFD | 0.83205 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
2 | Q9Y6R6 | ZNF780B | 0.6 | |
3 | O60928 | KCNJ13 | 0.59386 |
transmembrane transport
GO:0055085 transport GO:0006810 |
4 | Q96EC8 | YIPF6 | 0.56489 |
anatomical structure development
GO:0048856 cell differentiation GO:0030154 |
5 | P02708 | CHRNA1 | 0.56254 |
anatomical structure development
GO:0048856 cell junction organization GO:0034330 cell-cell signaling GO:0007267 ... |
6 | O14495 | PLPP3 | 0.47673 |
biosynthetic process
GO:0009058 cell adhesion GO:0007155 cell-cell signaling GO:0007267 ... |
7 | Q8NDV3 | SMC1B | 0.46919 |
cell cycle
GO:0007049 chromosome organization GO:0051276 chromosome segregation GO:0007059 ... |
8 | Q495C1 | RNF212 | 0.44005 |
cell cycle
GO:0007049 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
9 | Q68DY9 | ZNF772 | 0.41817 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
10 | P53794 | SLC5A3 | 0.40364 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
20 40 60 80 100
AA: MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIFVDRDGDLFSFILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNP
STMI:
DO_DISOPRED3: DD..................................................................................................
DO_IUPRED2A: ....................................................................................................
DO_SPOTD: DDD.................................................................................................
CONSENSUS: DD..................................................................................................
CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200
AA: YLLQPRPALVEVHFLSRNTQAFFRVFGSCSKTIEMLTGRITVFTEQPSAPTWNGNFFPPQMTLLPLPPQRPSYHDLVFQCGSDSTTDNQTGVRYVSIKPD
STMI:
DO_DISOPRED3: ........................D.........D.DD..DD..DD......................................................
DO_IUPRED2A: ..........................................................................................DDD.......
DO_SPOTD: ....................................................................................................
CONSENSUS: ....................................................................................................
CONSENSUS_MOBI: ....................................................................................................
220 240 260
AA: NRKLANGTNVLGLLIDTLLKEGFHLVSTRTVSSEDKTECYSFERIKSPEVLITNETPKPETIIIPEQSQIKK
STMI:
DO_DISOPRED3: ........................................................DDDDDDDDDDDDDDDD
DO_IUPRED2A: ..................................................D.D..DDDD..DDDDDD.....
DO_SPOTD: ......................................................DDDDDDDDDDDDDDDDDD
CONSENSUS: .......................................................DDDDDDDDDDDDDDDDD
CONSENSUS_MOBI: ........................................................................
RICH_fLPS_[I]: tpkpetIIIpeqsqI